KEGG   Candidatus Pelagibacter ubique: SAR11_1048
Entry
SAR11_1048        CDS       T00257                                 

Gene name
glyA
Definition
(GenBank) glycine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00260  Glycine, serine and threonine metabolism
pub00630  Glyoxylate and dicarboxylate metabolism
pub00670  One carbon pool by folate
pub00680  Methane metabolism
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
pub01120  Microbial metabolism in diverse environments
pub01200  Carbon metabolism
pub01230  Biosynthesis of amino acids
pub01240  Biosynthesis of cofactors
Module
pub_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAR11_1048 (glyA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAR11_1048 (glyA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAR11_1048 (glyA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAR11_1048 (glyA)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_1048 (glyA)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SAR11_1048 (glyA)
SSDB
Motif
Pfam: SHMT DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase Ubiquitin_5
Other DBs
NCBI-ProteinID: AAZ21854
UniProt: Q4FLT4
LinkDB
Position
complement(1018725..1020035)
AA seq 436 aa
MSSEKNYLNENYKSFFDDSLSVTDPELHKAISDELKRQQQHIELIASENIVSQAVLEAQG
SVLTNKYAEGYPGKRYYNGCEHVDVAENLAIERLKKIFDCKFANAQPHSGAQANGAVFLA
LLNPGDTFMGMSLNSGGHITHGLKISMSGKWFNPIGYDVDKESELIDYDNVEKLALEHKP
KLIICGGSAYSRVIDFKRFREIADKVGAYLMVDMAHFSGLVAGKGYPNPCEHAHVVTSTT
HKVFRSARGGIILTNHEDLAKKFNTAVFPGYQGGPLMHVIAGKAAGFLEALRPDFKDYIK
SVLANAKILSETLKNNGFKIYSGGTDTHLMLVDLRPFNVKGNAAAESLSNANITCNKNGI
PFDSEKPMITSGIRLGTQAATTRGFGLKEFEKVGELITKVVKGLSENPEDNGKIEEEVRN
EVIDLTSNFPIYKNLK
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtctagtgaaaaaaactatttaaatgaaaattataaaagcttttttgatgacagctta
tctgtaactgatccagaattacataaagccataagtgatgagctaaaaagacaacaacaa
catatagaattaattgcttctgaaaatatagtttctcaagctgttttagaggctcaaggc
tctgtattaacaaataaatatgcagaaggatatcctggaaaaagatactataatggatgt
gagcatgttgatgttgctgaaaatttagccatagagagattaaagaaaatttttgattgt
aaatttgcaaatgcccaaccacattctggggctcaagcaaatggtgctgtatttttagcg
ctattaaatcctggtgatacatttatgggaatgagtttaaattctggtggacatattact
catgggttaaaaatatcaatgtcaggtaaatggtttaatcccatagggtatgacgttgat
aaagagtctgaacttattgattatgataatgttgaaaaacttgcattagaacataaacca
aaactcataatttgtggtggtagcgcttattctagagtaattgactttaaaagatttaga
gagattgctgataaagtaggggcatatttgatggtggatatggctcatttttcaggttta
gttgctggtaaaggttatcctaacccatgtgaacacgcacacgtagttacttcaacaact
cataaagttttcagaagtgctagaggtggaattattttaactaatcatgaagacctagca
aaaaaatttaatactgcagtatttcctggttatcaaggtggaccgttgatgcatgtcatc
gctggaaaggctgctgggtttttggaagctttaaggccagattttaaagattatatcaaa
tcagttttggcaaatgccaaaattttatctgagacacttaagaataatggttttaaaatt
tattctggtggaacggatactcatttaatgttagttgatctaagacctttcaatgttaag
ggtaatgccgctgctgaaagcctttctaatgctaatattacctgtaacaaaaatggaata
ccttttgactctgaaaagccaatgattacttctgggataagacttggaactcaagctgca
acaactagaggctttggtttaaaagagtttgagaaagtaggtgaattaattactaaagtt
gtaaaaggtttgtctgaaaaccctgaggacaacggtaaaattgaagaagaggttagaaat
gaagttatagatcttacatctaactttccaatatataaaaatttgaaataa

DBGET integrated database retrieval system