KEGG   Candidatus Pelagibacter ubique: SAR11_1264
Entry
SAR11_1264        CDS       T00257                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01120  Microbial metabolism in diverse environments
pub01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_1264 (metF)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SAR11_1264 (metF)
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-ProteinID: AAZ22068
UniProt: Q4FL70
LinkDB
Position
1201343..1202071
AA seq 242 aa
MNFSLEVGPQTDLNTLPPVKDVYVTMLPGGDYKETANQTAALVKKGFNPVPHFPARSITD
DAQLKDYIVRCKDVGAKQALVIGGSREPVGKFDSSIQILETGFFDGIKIGIAGHPEGSQD
ISDKELEKAMIDKKPYADYIVTQWLLESQPIVDFISKQSVPVHVGITGPMKITSLIKFAN
IVGAKNSINFLKSNFSKALDLLKPKDPNELIGKVKEFTGNFHIYTFGGLKETNKWLKENG
YV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaatttttcacttgaggttggacctcaaacagatcttaatacactgcctcccgttaag
gatgtttatgtaactatgcttccaggaggagactataaagagacagctaaccaaacagcg
gcgttagttaaaaaaggatttaatccagttccacattttccagcacgatcaattacggat
gatgctcagcttaaagattacattgtaagatgtaaagatgtgggtgctaaacaagcttta
gttattggaggaagtagagagccagttggaaaatttgatagttcaattcaaattttagaa
acaggattttttgatggaattaaaataggaatagcaggacatccagagggaagtcaggat
atttctgataaagaattagaaaaggctatgatagataaaaaaccttacgccgactatata
gtgacccagtggttattagagagtcaacctatcgtagatttcatttctaagcagtcagta
ccagtgcatgtaggaattactgggccaatgaaaataactagcttaattaaatttgctaat
attgtcggggcgaaaaattctataaattttcttaagtctaattttagtaaggcattagat
ttattgaaacctaaagaccctaatgaattaattgggaaagtgaaagagtttactggtaac
ttccacatttatacattcggcggcttgaaggaaacaaacaagtggttgaaggagaacggt
tatgtctaa

DBGET integrated database retrieval system