KEGG   Candidatus Pelagibacter ubique: SAR11_1285
Entry
SAR11_1285        CDS       T00257                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01120  Microbial metabolism in diverse environments
pub01200  Carbon metabolism
pub01240  Biosynthesis of cofactors
Module
pub_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_1285 (fhs)
Enzymes [BR:pub01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SAR11_1285 (fhs)
SSDB
Motif
Pfam: FTHFS Nas2_N
Other DBs
NCBI-ProteinID: AAZ22089
UniProt: Q4FL49
LinkDB
Position
1218954..1220639
AA seq 561 aa
MSEVKSDIQIAREAKMQPINDILAKINVPDESSAFSPMGRHIAKINLEYLDTLKDKPNGK
LVLVTAITPTPAGEGKTTTSVGLNDGLNKIGKKSIVCLREPSLGPSFGMKGGAAGGGYAQ
VVPMEQINLHFTGDFHAITSAHNLLSALIDNHIYWGNKLDIDVRRIVWKRVMDMNDRSLR
SININLGGVANGFPREDGFDITVASEIMAIFCLSNDLEDLEKRIGNITIAYTRDKKPVYA
KDLKAQGPMTVLLKDAIRPNVTQTLENNPAIIHGGPFANIAHGCNSVIATKTGLKLADYV
VTEAGFGADLGAEKFLDIKCRKSDLKPSCVVIVATIRALKMHGGVAKDDLKTENVEALKK
GLVNLQRHVENVKKFGLPVAVAVNHFIKDTENEVKALIEFCDTIGVKASLCTHWANGGEG
TKELASHVAELCEKNEDKFKFLYESKTPLFKKIETIAKEIYRADEVIADTKIRDQLKSFE
DAGYGDFPICIAKTQYSFSTDPSLKGAPTGHSLPIREIKLSSGAEFIVVICGAVMTMPGL
PRVPAADSIKLNKDGEIEGLF
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgagcgaagttaagtcagacattcaaatagctagagaagctaaaatgcaacctataaat
gatattttagccaagataaatgtgcctgatgaaagctcagcttttagtccaatgggaaga
cacatagcaaagattaatttagaatatttagatactttaaaagataaaccaaatggaaaa
cttgtattagtgacagcaatcactcctacaccagctggtgaaggaaaaaccacaacttca
gttggtttaaatgatggattaaacaaaattggaaaaaaatctattgtttgtttaagagag
ccaagccttggtccctcttttggaatgaaaggtggagcagcaggtggcggttatgctcaa
gtagttccaatggaacaaattaatttacattttactggagattttcatgcaataacatca
gctcataatttgttgtcagccttaattgataatcatatctattggggaaataaactagat
atcgatgttagaagaattgtctggaaaagagtaatggatatgaacgatcgttctttaaga
tctataaatataaacttaggtggagttgcaaatggttttccaagagaagatggttttgat
attactgttgcatctgaaatcatggcaatcttttgcttatcaaatgatttagaagattta
gaaaagagaataggaaatattacaattgcttatactagagataaaaaacctgtttatgct
aaagatttaaaagcacaaggtccaatgacagtattattaaaagatgcaattcgacctaac
gttactcaaactttagaaaataatcctgcaattattcatggtggcccttttgctaacatt
gctcatggctgtaattctgtaattgcaacaaagactggactaaaacttgctgactatgtt
gtgacagaagcaggatttggcgcagaccttggtgcagaaaaattccttgatattaaatgt
agaaaatcagatttaaaacctagctgtgttgtaattgttgcaactattagagcattaaaa
atgcatggtggtgtagcaaaagatgatcttaaaacagaaaatgtagaagccttaaaaaaa
ggtctagttaaccttcaaagacatgtagaaaatgtaaaaaaatttggtttgccagttgca
gtagctgttaatcattttattaaagatacagagaatgaagtaaaagctttgatagaattt
tgtgacactattggagttaaagcaagtctttgtactcattgggcaaatggtggcgaaggt
acaaaagaacttgcaagtcatgttgctgaattatgtgagaaaaatgaggataaattcaaa
ttcttatatgaaagtaaaactcctctatttaaaaaaatagaaacaattgcaaaagaaatt
tatagagcagatgaggttattgcagatactaaaataagagatcaattaaaaagctttgaa
gatgctggatatggtgactttccaatttgtattgcaaaaactcaatacagcttctcaaca
gatccaagcttaaaaggtgcaccaacaggacactctttaccaattagggagattaaactt
tcttctggtgcagagtttattgttgttatatgtggagccgttatgacaatgcctgggtta
ccaagagttccagcggcagattcaattaagctaaataaagatggtgaaattgaaggtcta
ttttag

DBGET integrated database retrieval system