KEGG   Pelosinus sp. UFO1: UFO1_1346Help
Entry
UFO1_1346         CDS       T03211                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00473  D-Alanine metabolism
puf00550  Peptidoglycan biosynthesis
puf01100  Metabolic pathways
puf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UFO1_1346
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UFO1_1346
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    UFO1_1346
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:puf01011]
    UFO1_1346
Enzymes [BR:puf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     UFO1_1346
Peptidoglycan biosynthesis and degradation proteins [BR:puf01011]
 Precursor biosynthesis
  Amino acid ligase
   UFO1_1346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A ATPgrasp_ST RimK
Motif
Other DBs
NCBI-ProteinID: AIF50901
UniProt: A0A075K9K9
LinkDB All DBs
Position
1500951..1502048
Genome map
AA seq 365 aa AA seqDB search
MEKKNIAILFGGNSTEHEVSLQSAKNVIGAIDKEKYEITLIGIDKDGQWYLCDNEDFLVN
EHNPKEIKLKHTEISVVLQQGKVEQQLLCFGKTSFTKSIDVVFPILHGACGEDGTVQGLL
KLANLAFVGPSLLGSAIGMDKDVTKRLLRDAGIPTAKCLTYKKWEQGKMKFTKVVEELGL
PIFVKPANLGSSVGINKVRNEDEFCKAIQEAFAFDSKILLEEFIQGQEIECAVLGNETPD
ASILGAVIPQQDFYSYDAKYIDDKGANLQIPAQLSSELTYRMQELAKKAFQVLCCEGMAR
VDFFLTKESAIYINEINTIPGFTAISMYPKLWEYSGIAYKDLIDKLIQLALERYQREEAL
QKKYF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaatattgccatattgtttggtggaaattcaacagaacatgaagtttct
ttgcaatcagcaaagaatgtaattggcgcaattgataaagaaaaatatgaaattacttta
attggtatagacaaagatggacaatggtatttatgtgataatgaagattttttggtcaat
gagcataacccaaaagaaattaaactgaaacatacggagatttctgttgtcttacagcaa
gggaaggtagaacaacaacttttgtgctttggaaaaaccagttttacaaaaagtattgat
gtggtttttcctatcctccatggggcatgtggcgaggatggaacagtacaagggttgtta
aaactagccaatttagctttcgtaggccctagtcttttgggttcagcgattggtatggat
aaggatgttacgaaacgcttactcagagatgctggaatccccactgcgaaatgtttgaca
tacaaaaagtgggagcagggcaagatgaaatttactaaggtagtagaagaattagggctg
ccgatttttgtgaaacctgccaaccttggctcttcagtaggaattaataaggtcagaaat
gaagatgaattctgtaaggcgattcaagaagcctttgcctttgatagtaaaatcttgcta
gaggagtttatccaggggcaggagattgaatgtgccgttttaggcaatgaaactcccgat
gcttctatcctcggagcagtgattccgcaacaagatttttactcctacgatgcaaaatat
attgatgataaaggagccaacttgcaaattcctgcacaactttcaagtgaattgacttat
aggatgcaagagcttgctaaaaaagccttccaagtgttatgctgtgaaggaatggctcgg
gttgattttttcttaacgaaagaatctgcaatttatattaatgagattaatacaatccca
ggttttacagcaatcagcatgtatcctaagctttgggaatatagtggcattgcttataaa
gacctaattgataaactaattcagctagctttagaaagatatcaaagagaagaagcatta
caaaaaaaatatttttaa

DBGET integrated database retrieval system