KEGG   Pelosinus sp. UFO1: UFO1_1379Help
Entry
UFO1_1379         CDS       T03211                                 

Definition
(GenBank) Phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00340  Histidine metabolism
puf01100  Metabolic pathways
puf01110  Biosynthesis of secondary metabolites
puf01230  Biosynthesis of amino acids
Module
puf_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    UFO1_1379
Enzymes [BR:puf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     UFO1_1379
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     UFO1_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH DUF1265
Motif
Other DBs
NCBI-ProteinID: AIF50934
UniProt: A0A075K9Y0
LinkDB All DBs
Position
1533640..1534296
Genome map
AA seq 218 aa AA seqDB search
MINLEGIKFDENGLIPAIIQEEETGKVLMLAYMNEESVRKTIETKVTWFYSRSRQSLWQK
GETSGHVQHVKQIRYDCDGDTLLLQVEQIGVACHEGTLSCFSRILGDTKLQEEKLVDTSE
IYGQSVATVLNELFHVINDRKRNPIAGSYTTYLFEKGQDKILKKVGEEAAETIIGSKNNS
KEELLYEMADLWYHCLVLLVQHDVSLTELLEELQKRRK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacttagaagggataaaatttgatgaaaatggcttaatcccagctattattcag
gaagaagaaacaggcaaggttctcatgctggcctatatgaatgaagaatcagtaagaaaa
acaatagaaactaaggtcacttggttttatagccgcagtcgtcaaagcttatggcaaaag
ggggaaacatcgggtcatgtgcagcatgtgaagcagattcgttatgactgtgatggtgac
acccttttacttcaagtagaacaaattggtgtagcctgtcatgaaggaacattatcttgc
tttagtcgtatcctcggggatactaaattgcaagaagaaaagctcgtagatactagtgaa
atctatggacaatccgtagctacagtactaaatgagttattccatgtaattaatgatcgt
aaacgtaacccaatagcaggatcttatactacttatctctttgaaaagggccaggataaa
attctgaaaaaagtaggagaagaagctgcagaaactattattggttctaaaaataatagt
aaagaagaactactttatgaaatggcagatctttggtatcactgcttagtattattagta
cagcatgatgtgagtcttactgagctattagaagaattacaaaaaagaagaaaataa

DBGET integrated database retrieval system