KEGG   Pelosinus sp. UFO1: UFO1_3062Help
Entry
UFO1_3062         CDS       T03211                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00020  Citrate cycle (TCA cycle)
puf00190  Oxidative phosphorylation
puf00650  Butanoate metabolism
puf01100  Metabolic pathways
puf01110  Biosynthesis of secondary metabolites
puf01120  Microbial metabolism in diverse environments
puf01130  Biosynthesis of antibiotics
puf01200  Carbon metabolism
Module
puf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UFO1_3062
   00650 Butanoate metabolism
    UFO1_3062
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UFO1_3062
Enzymes [BR:puf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UFO1_3062
    1.3.5.4  fumarate reductase (quinol)
     UFO1_3062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_20 Fer4_10 Fer4_17 Fer4_9 Fer4_16 Fer4_18 Cytochrom_C550 Fer4_13 Fer4
Motif
Other DBs
NCBI-ProteinID: AIF52605
UniProt: A0A075KEW6
LinkDB All DBs
Position
complement(3211270..3212028)
Genome map
AA seq 252 aa AA seqDB search
MAETKKKVHFIIERQDGPNSQPYTEEFEVDYRPALNVVASLMEIQKNPVTKDGKKTTAVV
WECNCLEKVCGACMMVINGKAQQACAALIDHLEQPIRLSAARTFPVIRDLAIDRSVMFDS
LKRIHGWVDVDGTWEVHNDAPRQNPKTATTAYEISRCMTCGCCMHACPNVNQGSEFIGPA
PIAQAHLFNLHPIGEYQKEERLDALMEKGGLASCGNSQNCVKACPKEIKLTEYIAKLNRD
TNKQALKSLFNK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacaaagaaaaaagtacattttatcatagaaagacaagatggtcctaattcc
caaccctatacagaagaatttgaagttgactatcgtcctgcgcttaatgttgttgcatct
cttatggagattcaaaagaaccctgttacaaaagacggcaaaaagacaactgctgttgtt
tgggaatgtaattgtctggaaaaagtttgtggagcttgcatgatggtcatcaacggtaaa
gcacaacaggcttgtgctgctctaattgatcatctagaacaaccaattcgtttgagtgct
gctagaactttccctgttatccgtgaccttgcgattgaccgttcggtaatgtttgatagt
ttaaaacgcatacacggctgggtagatgtagatggaacctgggaagttcataatgatgct
ccgcgtcagaatccaaaaactgcaactaccgcttatgaaatttctcgttgcatgacttgc
ggatgctgcatgcatgcttgtccaaatgtaaatcaaggctctgagttcattgggcctgct
cctattgcacaagcacatctctttaatctccacccaattggcgaatatcagaaagaagaa
cgcttggatgcattgatggaaaagggcggtttagcaagttgcggtaatagccaaaactgc
gtaaaagcatgtccgaaagagattaaattgactgagtatatcgcaaaactgaatcgtgat
acaaacaagcaagcactgaagagcttatttaataaataa

DBGET integrated database retrieval system