KEGG   Pelosinus sp. UFO1: UFO1_3063Help
Entry
UFO1_3063         CDS       T03211                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00020  Citrate cycle (TCA cycle)
puf00190  Oxidative phosphorylation
puf00650  Butanoate metabolism
puf01100  Metabolic pathways
puf01110  Biosynthesis of secondary metabolites
puf01120  Microbial metabolism in diverse environments
puf01130  Biosynthesis of antibiotics
puf01200  Carbon metabolism
Module
puf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UFO1_3063
   00650 Butanoate metabolism
    UFO1_3063
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UFO1_3063
Enzymes [BR:puf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     UFO1_3063
    1.3.5.4  fumarate reductase (quinol)
     UFO1_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 MazG HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: AIF52606
UniProt: A0A075KEP5
LinkDB All DBs
Position
complement(3212046..3213797)
Genome map
AA seq 583 aa AA seqDB search
MKKKIIVVGGGLSGLMATLKICEAGGEVELFSYCPVKRSHSLCAQGGMNACMDTKGENDT
VHEHFDDTVYGGDFLADQTAIKGMCEAAPKLIKMFDRMGVTFTRTPEGLLDLRNFGGQKN
KRTLFSGSTTGQQLLYALDEQVRAWEVKGAVKKYEFWEFIKIIKNKENVCRGIVAQDMNS
MEIRAFRADTVILATGGPGMVFGRCTASTICNGSAVSAVYQQGALIGNPEFIQIHPTAIP
GSDKNRLMSEACRGEGGRVWVYKDGKPWYFLEEMYPAYGNLVPRDVASRAIYDVCVNQKL
GINGENKVYLDLSHIPADYLERKLGGILEIYSEFVGDDPRKVPMQIYPSVHYSMGGIWVD
TKHNTNIPGLMASGECDYQYHGANRLGANSLLSAAYSGTVSGPEAMRWAKEGEKGSELTD
EELANAAKECQEEYDAILKMNGSENAHELHHELGDLMNQYVTIERVNKDLDYCFDEVKKI
LKRWDNIGIVDKANWANQEGMFARQLRNMIIYALVVTKAARMRDESRGAHYKREFPTRDD
ERFMKITVAEYDQATAEPKISYDDFDHSLVKPRPRNYAVAKKE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagaaaattatagttgttggcggcggtttatccggcctcatggcaacacttaaa
atttgtgaagctggcggagaagtagaattattctcgtattgccccgtaaaacgttctcat
tccctttgtgcacaaggcggtatgaatgcttgtatggatacaaagggtgaaaatgatact
gtccatgaacactttgatgatactgtttatggtggtgacttccttgctgaccagactgca
ataaaaggcatgtgtgaagccgctccaaaattaattaaaatgttcgatcgtatgggtgtt
acatttactcgtacaccagaaggtttacttgaccttcgtaattttggtggtcagaaaaat
aaacgtactttgttttctggttccacaacaggtcagcaacttctttatgcacttgacgaa
caagttcgtgcttgggaagttaaaggtgctgttaagaaatatgaattctgggaattcatt
aaaattattaaaaataaagaaaacgtttgccgcggtattgtagcacaagacatgaattct
atggaaatcagagctttccgtgctgatacggttatccttgcaacaggcggtcctggtatg
gtattcggtagatgtactgcttcgacaatctgcaatggttcagcagtatctgccgtatat
cagcaaggcgctcttattggtaaccctgaatttattcagattcatccaacagctattcct
ggttccgataaaaaccgcttgatgtctgaagcttgccgtggtgaaggcggacgagtttgg
gtttataaagatggtaaaccatggtacttcttggaagaaatgtatcctgcatatggtaac
cttgtacctcgtgacgtagcatctcgtgctatttacgatgtatgcgtaaatcaaaaactt
ggtatcaatggtgaaaacaaagtatatcttgatctttcccatattccagcagattatctt
gaacgtaaattaggcggcattttggaaatttattcggaattcgttggcgatgacccacgt
aaagttccaatgcaaatttatccttccgttcattattccatgggcggtatctgggtagat
acaaaacataacacaaacattcctggtcttatggcatctggtgaatgtgactatcaatac
cacggtgcaaaccgtcttggtgcaaactcacttctttccgctgcttattctggtactgtt
tcaggtccggaagctatgcgctgggctaaagaaggagaaaaaggttcagaacttactgat
gaagagttagcaaatgcagcaaaagaatgccaagaagaatatgatgctattttaaaaatg
aatggatcggaaaatgcgcatgaacttcaccatgaacttggtgatttaatgaaccaatac
gtcaccattgaacgtgtgaacaaagaccttgattattgtttcgatgaagtaaagaaaatt
cttaaacgttgggataatatcggtatagtcgataaagcaaactgggcaaaccaagaaggt
atgttcgcaagacagctccgcaatatgattatttacgctttagttgtaacaaaagcagca
cgtatgcgtgatgaaagccgtggggctcactacaagcgcgaatttccaacccgtgatgac
gaacgcttcatgaaaataacagttgctgagtatgaccaggcaacagcagagcctaagatc
agttatgatgattttgatcattcattggttaaaccgcgtcctcgtaactatgctgttgct
aagaaagagtaa

DBGET integrated database retrieval system