KEGG   Pelosinus sp. UFO1: UFO1_4710Help
Entry
UFO1_4710         CDS       T03211                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
puf  Pelosinus sp. UFO1
Pathway
puf00473  D-Alanine metabolism
puf01100  Metabolic pathways
puf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:puf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UFO1_4710
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    UFO1_4710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:puf01011]
    UFO1_4710
Enzymes [BR:puf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UFO1_4710
Peptidoglycan biosynthesis and degradation proteins [BR:puf01011]
 Precursor biosynthesis
  Racemase
   UFO1_4710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIF54245
UniProt: A0A075KJT1
LinkDB All DBs
Position
5003363..5004475
Genome map
AA seq 370 aa AA seqDB search
MSERAVWAEIDLSAIAHNMKQIRAVTRRSAKVCAVVKADAYGHGAIAVAKTALQAGADRL
AVAIVAEAIELRRAGIEVPILVLGYTPTCQSRLVAEYDITQTIFSLDTAQALSGAAVALG
KIIKVHIKIDTGMARIGIPPQEAGAFAATVAALPGIEIEGVYSHFADSDSLDKTFTFKQY
DRFMEGIEYVKGHNINIPIRHIANSAALLELPEMHLDMVRPGIILYGLWPSDEVKKTVEL
RPAMKFKTQIGFIKDVLPQTSISYGRTYFTPKASRIATLPLGYADGWSRLLANKAEVLVH
GYRAPVVGRVCMDQCMIDVSHIPGAKIGDEVLLFGGASLPVEEVAEKIGTINYEVVCMLG
NRVPRIYGTE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagggcagtttgggcagaaattgatttatcagcaattgcgcataacatgaaa
caaatcagagcagtcacaagaagaagtgcaaaggtttgtgcagttgttaaagctgatgcg
tatggacatggggcaatagcagtggcaaaaacagcattacaggcaggtgctgatcggctg
gcggtagccattgtggcggaagcgatagaattaagacgggccggaattgaggtcccaatt
ttagtgttaggatatacacctacttgtcaatctaggttagtggcagagtatgatattacc
caaactatattttctttagatactgctcaggcattatctggagctgccgtggctctaggt
aaaataataaaggtacatatcaaaattgatacaggaatggcgagaattggcattccacct
caagaagcaggagcatttgctgcgacggtagctgctttgcccggcattgaaattgaaggt
gtatattcacattttgcggattcagatagtctagataagacatttacctttaaacagtat
gatagatttatggaaggtattgaatatgttaaagggcacaacattaatataccaatccga
catattgcaaatagcgcagccttattagaattgcctgagatgcatctcgatatggtaagg
cccggtatcattctatatgggttatggccttctgatgaggtgaaaaaaaccgttgaactt
agacccgccatgaaattcaagacccaaataggatttataaaggatgtactaccgcaaact
tcgataagttatggaagaacttactttacgccaaaggcaagtcgtatagcaacgttacct
ttgggttatgcggatggttggtcgcgtttattagccaataaggcagaggtcttggtacat
ggctatagggcgccagtagtggggcgggtatgtatggaccagtgtatgatagatgtgagt
cacattcctggagccaagattggtgatgaagtacttttgtttggtggggcttcgttgccg
gtggaagaagtagcagaaaagattgggaccattaactatgaagttgtatgtatgttagga
aatagggtgcctaggatctatggaacggaatga

DBGET integrated database retrieval system