KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_0227Help
Entry
NT08PM_0227       CDS       T02057                                 

Definition
(GenBank) sialidase NanB
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Pathway
pul00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pul00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NT08PM_0227
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NT08PM_0227
Enzymes [BR:pul01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     NT08PM_0227
Bacterial toxins [BR:pul02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   NT08PM_0227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 Autotransporter OMP_b-brl BNR
Motif
Other DBs
NCBI-ProteinID: AFI45386
LinkDB All DBs
Position
222578..225775
Genome map
AA seq 1065 aa AA seqDB search
MKKFNPSVLALSISSLLLTSTLTFGQIQQQDKALFGVKEHQESLLFHQSLVKQGSDNVPI
WRIPSLLRTKDGVLIAAADKRWQHRGDWGDIDTAIRISHDDGKTWGNITTILDLPSQNGE
KSPIRDDAPTFNPWAHRNNSSVPTYRNSAFLIDAQMVQDKRNGRIFLAVDMFPESTGLSG
TADNGVTEFGSGYVNIDGKQYLRLNKKEGYTSKQWTLRENGIVFNEKNEKTGYRVVINGD
PKKNFKDLGDVYDQDNNKLGNIYLKQTERNATVPFTAPNTSYFWLTHSDDNGKTWSSPID
LTSQVKKDWMRFFGTGPGVGIQTKKGNLLFPIYYINRHGKQSSALIISKDGGKTWDLGQS
PNDTRTELYGKNSETLNSNSSGHELTESQLVELQNGDLKLFMRNTSGRVMMSTSKDGGYS
WIETKQVPELNHGYSQLSVIKYSKKINGKEYIVFSGQSVSGNSGDNLRRDGKLFLGEVQE
SGEIKWDTTNLVREIVSQGKAAGQPNGYVYSSMAELGDGSIGLAYENTTDYTTIMYLPIE
MQEFFWKAGKIFSDVRQKEPLVFTYDGTETLEKIGDGVAIKRGEGESQSEINVSEGLLVL
DQQTKDGKNKAFTQLTLNNSGVAQVNSTQNIDRLVVNNGATGYLQFTVTDTHSPRLKINQ
DVTAHGQIVAVQVNLQKKLKPNDKGYYHAQGEELIAFKDNGQVKWRLVNDELKDGMYVYT
LASVAKPSVLRTTSQPHSLYLTNKLITADGKAVSTVAPLKAPLTVNARPQVNPVLASYLT
ANLALNKMSEQLQQSFMHETRLLQEKDRSIFVKYLNGKQKYGSNLSFIDYGYDFNASYSG
VMLGGKVWQSERGNHALYTALNKTSYKVTPKAVDGETKAKYHSWGGSINWHSNLPHNLIV
DLSVGYQKHKGDIEHAGHVRGYTFNIGADLGYRYQWMKNAFITPMVGLHYLYASLLDVND
QANKALLKYNNFNALKTNLGVDVNYRIGKFEVKGLLSYDMYQQKTRQLYVDDVAYKQGKL
ADTLHLNTQFVAHLTPRFAFSTEVGFQHARNKGQSSFAVGAHYQF
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttaatcctagtgtattggcgttgtccatatcaagtctgctactcacatcc
acattgacctttggtcaaatccagcaacaagataaagcactctttggtgtgaaagaacat
caagaaagcctactctttcatcagagcttagtaaaacaaggtagtgataatgtgccaatt
tggcgcattccgtctttattaagaacaaaagacggtgtattaattgccgccgcagataag
cgttggcaacaccgtggtgactggggcgatattgataccgcaatccgaattagtcatgat
gatgggaaaacatggggaaatattacaacgattttggatttgccatcacaaaatggagag
aaatcaccaattagagatgatgcgccaacgtttaatccttgggcacatcgtaataatagt
tctgtaccaacatatcgaaactcagcatttttgattgatgcacaaatggtacaagataag
cgcaatggtcgaatttttctggctgtagatatgtttccagaaagtactggcttatctgga
acagctgataatggcgttactgagtttggtagtggatatgtaaacattgatggaaaacaa
tacttaagacttaataaaaaagagggatatacttctaagcaatggactctgcgtgaaaac
ggaatagtttttaatgaaaaaaatgagaaaacgggatatcgagttgttataaatggcgac
cctaagaagaatttcaaagatctcggggacgtatatgatcaagataataataaacttgga
aatatttatttaaaacaaacagaaaggaatgcaacagttcctttcactgcacctaacacc
tcttatttttggctaactcattccgatgataatggaaaaacatggtctagtcctattgat
ttaacatcgcaagtgaaaaaagattggatgcgtttttttggcacaggacctggggtggga
attcaaacaaaaaaaggaaatttactctttcctatttattatattaatcgccatggtaaa
cagtcctctgcgctgattattagcaaagacggtggaaaaacatgggatttagggcaaagt
ccaaatgatacacgaaccgaattatatggtaagaattcagagacattgaatagtaactct
agtggtcacgaattaactgaatcacaattagtcgagttacaaaatggtgatttaaaactt
ttcatgcgtaatacaagtggtcgagttatgatgtctacttctaaagatggaggttatagt
tggattgaaactaagcaagtaccagagttaaatcacggctattcacaactttctgtcatt
aaatattccaaaaaaattaatggaaaagaatatattgttttttcagggcaatcagtgtcc
gggaatagtggtgataatctccgtagagatgggaaacttttcttaggagaagtgcaagaa
agtggtgaaataaaatgggatacaacgaatttagttagggaaatcgttagtcaaggtaaa
gcagcaggacagccaaacggctatgtttacagctcaatggcggaattaggtgatggcagt
attggtttagcttatgaaaatacgacagactacaccacaatcatgtatctccctattgaa
atgcaagaatttttttggaaagccggaaaaatctttagtgatgtgcgtcagaaagaacca
ttagtgtttacttatgatggaacggagacattggaaaaaattggcgatggggttgcgatt
aaacgtggtgaaggggaaagtcaaagtgaaattaatgtgagtgaaggcttgcttgtgttg
gatcagcaaacgaaagacggtaaaaacaaagcctttactcaacttacgcttaataactca
ggagtagctcaagttaattccacacaaaatattgatcggctcgttgtgaacaacggtgct
acggggtatttgcaatttacggtcacagatactcactctccacggcttaagattaatcaa
gacgtgactgcacatgggcagattgtggctgtacaagtcaacttacagaaaaaactcaaa
ccaaatgataaaggttattaccatgcccaaggagaagaactaatcgcatttaaggataat
ggacaagtcaaatggcgtttagttaacgatgaactaaaagatggcatgtatgtttatact
ttggcttcagtggctaaaccaagtgttttacgtacaacaagtcagccacattcactctat
ttaacaaataagttaattacagcagatggtaaagccgtatccacggtggctccattgaaa
gcaccattaaccgtaaatgctcgcccacaagtgaatccggtattagcttcttatttaacc
gccaatcttgcgcttaataaaatgagcgagcaacttcagcaaagttttatgcatgaaacg
cgtttattgcaagaaaaagatcgcagtatttttgttaagtatcttaatggtaaacaaaaa
tatggctcaaacttaagctttattgactatgggtatgattttaatgcgagttatagcggt
gtgatgttgggaggcaaagtatggcagtctgaacgtggtaaccatgccctgtatacagca
ttgaataaaacgtcctataaagtgacgccgaaagctgtagatggtgagacgaaagcgaaa
taccacagctggggaggaagtataaattggcatagtaacttgcctcacaatctgatagta
gatttatcagttggctatcaaaaacataagggcgacattgaacatgcaggtcatgtgaga
ggttatacttttaatattggtgcggatttaggttatcgctatcaatggatgaaaaatgcg
tttattacaccaatggtcggtttgcattatttatatgcctcgcttttagatgtcaatgac
caagcgaataaagcgttattgaaatataataatttcaatgcgttaaaaacgaatttaggt
gttgatgtgaactatcgaatcgggaagtttgaagtaaaaggtttactttcttacgatatg
tatcaacaaaaaacgcgtcaattgtatgttgatgatgtagcttataagcaaggtaaactg
gctgatacacttcatttaaatacacaattcgttgcccatttaacgccacgttttgcattt
tcaacggaagttggtttccagcatgcgcggaataaaggacagtcttcctttgctgttggg
gcacattatcagttctag

DBGET integrated database retrieval system