KEGG   Pasteurella multocida subsp. multocida 3480: NT08PM_1455Help
Entry
NT08PM_1455       CDS       T02057                                 

Definition
(GenBank) copper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pul  Pasteurella multocida subsp. multocida 3480
Brite
Enzymes [BR:pul01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NT08PM_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFI46573
LinkDB All DBs
Position
complement(1518091..1518651)
Genome map
AA seq 186 aa AA seqDB search
MKKTVLALMFSCGMVASAFAHNHAVEHKHTGEMLEVKVELLDPVKGNQEIGKVVITESAY
GLVFTPELKNLTAGLHGFHIHQNPSCDAKEKDGKLVAGLAAGGHWDPKNAGKHGYPWSDD
AHLGDLPALAVNQDGTANNPVLAPRLKHLDDVKGRSLMIHEGGDNHDDHPAPLGGGGPRM
ACGVIK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagtattagccctgatgttttcttgtggtatggtggcttctgcatttgcg
cataatcatgcggtggaacataaacataccggcgaaatgctagaagtgaaagtagagttg
ctggatccggttaaaggtaatcaagaaatcggtaaagtcgtgattactgaatctgcttat
ggtttggtctttacgccagaattgaaaaatttaacggcgggtttgcatggtttccatatt
catcaaaacccaagctgcgatgccaaagaaaaagacggcaagttagtagcggggttggca
gctggtggacattgggatcctaaaaatgcaggtaaacatggttacccgtggtcggatgat
gcccatttaggtgatttacctgcgttagccgtgaaccaagatggtactgcaaataaccca
gtgttagcgccacgtttgaaacatttggacgacgtgaaagggcgttcattaatgattcat
gagggcggtgataaccatgatgatcacccagcaccattaggtggtggtggtccacgtatg
gcttgcggtgtgatcaaataa

DBGET integrated database retrieval system