KEGG   Psychrobacter urativorans: AOC03_04310Help
Entry
AOC03_04310       CDS       T04087                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
pur  Psychrobacter urativorans
Pathway
pur00020  Citrate cycle (TCA cycle)
pur00270  Cysteine and methionine metabolism
pur00620  Pyruvate metabolism
pur00630  Glyoxylate and dicarboxylate metabolism
pur00680  Methane metabolism
pur01100  Metabolic pathways
pur01110  Biosynthesis of secondary metabolites
pur01120  Microbial metabolism in diverse environments
pur01130  Biosynthesis of antibiotics
pur01200  Carbon metabolism
Module
pur_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pur_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pur_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOC03_04310
   00620 Pyruvate metabolism
    AOC03_04310
   00630 Glyoxylate and dicarboxylate metabolism
    AOC03_04310
  09102 Energy metabolism
   00680 Methane metabolism
    AOC03_04310
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AOC03_04310
Enzymes [BR:pur01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AOC03_04310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ALF59372
UniProt: A0A0M4SWY6
LinkDB All DBs
Position
complement(990824..991807)
Genome map
AA seq 327 aa AA seqDB search
MKQPVRVAVTGAAGNISYAMLFRIASGEMLGKDQPVILQLLEIAPALDALKGVVMELEDC
AFPLLAGIVQTDDATVAFKDIDYALLVGSRPRGPGMERKDLLEANAAIFSAQGKALNDVA
SRDVKVLVVGNPANTNAVIAQRNAPDLDPRNFTAMTRLDHNRAMAQLAGKTDSTVNDVKK
MTIWGNHSSTQYPDLTACTVKGKPALDLVDREWYEATYIPEVQQRGAAIIKARGASSAAS
AANAAIAHVRTWVMGTDENDWVSMGVYSNGEYGISKGLIYSFPCTCKDGDWAIVEGVDVS
SAFSKEKMAATEQELNEERDAVSHLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcctgttcgtgttgccgtaactggtgctgctggtaatatcagctatgccatg
cttttccgtatcgcctctggtgagatgctgggtaaagaccaaccggttattttgcaatta
cttgaaatcgctcctgcccttgacgcgctaaagggtgtggtcatggaattagaagactgt
gcatttcctttattagcaggtattgtacaaactgatgatgcaacggtagcattcaaagat
atcgactatgccttattagtgggttcacgtcctcgtggtccaggtatggaacgtaaagat
ttgctagaagccaacgcggcgattttctcagcgcaaggtaaagccttgaatgacgtcgct
agccgtgatgttaaagtattggtagtcggtaaccctgccaacaccaacgcggttattgct
caacgtaatgcaccagatttagacccacgtaactttacggcgatgactcgtttagaccac
aaccgtgctatggcgcagttggctggtaaaacagacagcactgtgaatgacgtgaaaaaa
atgaccatctggggcaaccattcatccactcagtatcctgatctgactgcttgtaccgtt
aagggtaagccagctttggatttagttgatcgtgaatggtacgaagccacttatatccca
gaagtacaacaacgcggtgcagcaatcattaaagctcgtggtgcatcatctgccgcttca
gctgctaatgcggctattgcacacgtacgcacgtgggtaatgggtactgatgagaatgat
tgggtatcaatgggcgtttattcaaacggcgaatatggtatctctaaaggcttaatttac
tcattcccatgtacctgtaaagatggcgattgggctatcgttgaaggtgttgatgtatca
tcagctttctcaaaagagaaaatggcagctactgagcaagagcttaacgaagagcgtgat
gcggtttcacatcttctaccataa

DBGET integrated database retrieval system