KEGG   Psychrobacter urativorans: AOC03_04470Help
Entry
AOC03_04470       CDS       T04087                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pur  Psychrobacter urativorans
Brite
KEGG Orthology (KO) [BR:pur00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOC03_04470
Enzymes [BR:pur01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AOC03_04470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_oxidored FAD_binding_2 NAD_binding_8 Thi4 K_oxygenase DAO AlaDh_PNT_C NAD_binding_7 FAD_binding_3 Shikimate_DH Glutaredoxin Lycopene_cycl 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALF59399
UniProt: A0A0M4TUR2
LinkDB All DBs
Position
complement(1022142..1023731)
Genome map
AA seq 529 aa AA seqDB search
MIDQSLLDAVKSYSENMTRPISFVLGSGEHAKRAELIDFLTKIAGTTDKIQFNAQDDAFI
DSSLPSPISFAVRSHIDGTLTDTGIVFSGIPGGHEFTSLILAILQAGGHTLKLDEGIQKL
IKRINKPLQFQTFVSLSCHSCPDVVQALNQFALLNDGISNEMIDGALFQELVDANNIQGV
PAVFLNGKPFANGLIDTGKLIDKLQEQFPDLLSESSTDDAEQLEQQDVTIIGAGPAGVAA
AIYTARKGLKVTMVADRIGGQVKDTQDIENLISIPLTTGTTLSNNFVTHLQAYDITLKQS
VSVKEISETEDENYRIQLNTGETFTTRSIILATGAQWRKLNVPGEEENIGKGVAYCPHCD
GPFFKGKDVSVIGGGNSGIEAALDLAGIVKHVTVFEFADTLKADQVLINKAKEKANIEII
TGAATKEIKATDGKVTSIVYEERSSGEIKELDLAAIFVQIGLVPNSEFVKGFVDLNRFGE
IEIDERCRTDRKGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgatagaccaaagcttattagatgctgttaaaagttatagcgagaacatgacccgtccc
attagttttgtattgggcagtggtgaacatgctaaacgtgctgagctgattgacttctta
actaaaatcgctggtacaacggataaaattcaatttaatgctcaagacgatgcctttatt
gatagcagtttgccaagtccaattagctttgcagttcgtagtcatatcgatggtacgcta
acagatacgggtattgtctttagtggtattccgggcgggcatgaatttacctcgcttatt
ctagctattttgcaggcaggtggtcatacactaaagctcgatgagggtattcaaaagctt
atcaaacgtatcaataagccgctacagtttcaaacctttgtgtcactgtcctgccacagt
tgcccagatgtggtgcaagctttgaatcagtttgcactattaaatgatggcattagcaac
gagatgattgatggggcattattccaagagctagtcgatgccaataatatccaaggcgta
cctgcggtattcttaaacggtaagccctttgccaatggtttgattgatacgggtaaattg
attgataagttgcaagagcaattcccagatttattaagtgaaagtagcactgacgatgcg
gagcagttagagcagcaagatgtgacgattattggtgctggtcctgctggggttgccgct
gcgatttatactgcacgtaaaggcttaaaagtcaccatggtggcggatcgtatcggcggt
caggtgaaagacacgcaagatatcgagaaccttatctcgattccgttaaccacgggcacg
acgttatcgaataattttgtcacgcacttacaagcgtatgacatcacgctaaaacagagt
gtcagcgtaaaagaaattagcgaaactgaagacgagaactatcgtattcagctaaatacg
ggcgaaacgtttaccacgcgcagtattatcttagcgactggcgcacagtggcgtaaactg
aatgtaccgggcgaagaagaaaacatcggtaaaggtgtggcgtattgtccacattgcgat
ggtccattctttaaaggtaaagatgtatcggtgattggcggtggtaactcaggtattgaa
gccgcgctagatttggcaggtatcgtgaagcacgtgacggtatttgagtttgctgacact
ctaaaagctgaccaagtattgattaataaagcaaaagaaaaagccaatattgaaattatc
acgggcgcggcaaccaaagagattaaagccactgacggtaaagtgacctctatcgtctac
gaagagcgcagttcaggcgagataaaagagcttgatttagcggctatctttgtgcaaatt
ggcttagtacctaatagcgaatttgttaaaggctttgttgatttaaatcgctttggtgag
attgaaattgatgagcgctgccgcacagaccgcaaaggtatttttgcttgtggtgacgtg
acgaccgtaccgtttaagcaaattaatattgcgatgggtgagggtagtaaagcggcattg
tcagcgtttgagtatttggtgatgcagtag

DBGET integrated database retrieval system