KEGG   Psychrobacter urativorans: AOC03_04850Help
Entry
AOC03_04850       CDS       T04087                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pur  Psychrobacter urativorans
Pathway
pur00061  Fatty acid biosynthesis
pur00071  Fatty acid degradation
pur01100  Metabolic pathways
pur01212  Fatty acid metabolism
pur02024  Quorum sensing
Module
pur_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AOC03_04850
   00071 Fatty acid degradation
    AOC03_04850
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AOC03_04850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pur01004]
    AOC03_04850
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pur04147]
    AOC03_04850
Enzymes [BR:pur01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AOC03_04850
Lipid biosynthesis proteins [BR:pur01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AOC03_04850
Exosome [BR:pur04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AOC03_04850
  Exosomal proteins of breast cancer cells
   AOC03_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ALF59466
UniProt: A0A0M4TEI6
LinkDB All DBs
Position
complement(1114493..1116226)
Genome map
AA seq 577 aa AA seqDB search
MDNQDHLIRHNDKVWLKTYEALGLTYDIKLPADNTSLIDIFEQSFAKNGNKTAFVCMGSE
LTFQEVDLYSQQVAAYLQSLGLVKGDKVAVMMPNVLQLPVTIIGVLRAGLTLVNVNPLYT
TKELEHQLIDSEAKALILVENFAKTYQDIGRNIVDHVVITGMGDLMGTLKGFMVNTVVRY
VKKLVPKYKIAGSVSFNSMIKQVTISQYKRPTNITLDDVAVLQYTGGTTGVAKGAMLTHK
NLVANLIQCNTFLGSAFDEFDKSGEQAVIMTALPLYHIFSFTLCGMFGLYRGCVGLLIPN
PRDIDSLLKAYKEHPPALFPAVNTLFNALANNEEFKALDHSKLRVTMGGGMAVVSSTAEK
WRQITGNIIVQGYGLSETSPVATANPINSATFSGTIGVPMPATDVAILDDVGNEVALGER
GEIGVRGPQVMKGYWKRDDATAESMTSDGFFRTGDIGIMDENGYISIVDRKKNMILVSGF
NVYPNEVEEVMAGCHKILECGVIGVEDDKSGEVPKIFVVRRDASLTEEEVHAYAKEHLTG
YKRPRYVEFIDELPKSNVGKILHKDLRKLEADRHAKQ
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggacaatcaagaccatttaattcgacataacgataaagtttggctaaaaacttatgag
gcgcttgggctgacatatgatatcaagctgcctgcggataatacctcgctgattgatatt
tttgaacaaagctttgcgaaaaatggcaataaaactgcttttgtgtgtatgggttctgag
ttgacctttcaggaagtagatttatacagccagcaagtggcagcatacctgcagtcatta
ggcttggttaaaggcgataaagtcgcggtcatgatgcccaatgttttacaattaccagtt
accattattggtgtgctgcgcgctggcttgaccttagtgaatgtgaatccgttatacacc
accaaagagcttgagcatcagttgatagactctgaggcaaaagcacttattttagtggaa
aactttgccaaaacttatcaagatattggtcgtaatatcgtggatcatgtggtgatcacg
ggtatgggcgatttgatgggtacgctgaaaggcttcatggttaatacggttgttcgctat
gtcaaaaaactggtgcctaaatataaaatagcgggtagtgttagctttaacagcatgatt
aagcaagtaacgataagccaatataagcgtccaaccaatatcacccttgatgatgttgct
gtattgcaatataccggcggcacgacaggcgtcgctaaaggggcaatgctgacccataaa
aacttggtagctaacctcattcagtgcaatacctttttaggtagtgcctttgatgagttt
gacaaaagtggcgagcaggcagtgattatgacagctttaccgctgtatcatattttctca
tttaccctttgtgggatgtttggtctatatcgtggctgtgtcggcttattgattcctaat
ccgcgtgatattgacagcttattaaaagcgtataaagaacatccacctgcacttttccct
gctgttaatacgctatttaatgcccttgctaataatgaagagtttaaggcgttggatcat
agtaagttgcgcgtaacgatgggcggaggcatggcagtagtgagctcgactgcagaaaaa
tggcgtcaaataacgggcaatattatcgtccaaggctacggattatcggaaacatctcca
gtagccaccgccaatcctattaatagcgcgacttttagtggcactattggcgtaccgatg
ccagcgactgatgttgctattttagatgatgtgggtaacgaagtggcattgggcgaacgt
ggtgaaattggcgtgcgtggtccgcaagtcatgaaaggttattggaagcgtgatgatgca
acagcagaatcaatgaccagtgatgggtttttccgtaccggtgatatcggtattatggat
gaaaatggttatatcagcatcgttgatcgtaaaaagaacatgattttggtatccggtttt
aatgtctatcccaatgaagtcgaagaggtcatggcgggttgtcataagattctagagtgc
ggtgtcatcggtgttgaagacgataaaagtggcgaagtgcctaagatttttgtggtacgt
cgagatgcgagcttgacggaagaagaagtacacgcctatgcgaaagagcatctaacgggc
tataagcgtccacgttatgttgagtttatcgatgagctgccaaagtcgaacgtcggtaaa
atcttacataaagatttgcgtaaacttgaagcagaccgtcacgctaagcaatag

DBGET integrated database retrieval system