KEGG   Psychrobacter urativorans: AOC03_05185
Entry
AOC03_05185       CDS       T04087                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pur  Psychrobacter urativorans
Brite
Enzymes [BR:pur01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOC03_05185
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Other DBs
NCBI-ProteinID: ALF59524
UniProt: A0A0M4TUX2
LinkDB
Position
complement(1199068..1199697)
AA seq 209 aa
MSQITLPELPYAKNALEPYISAETLEFHHDKHHAAYVNKLNELLPGSGLEDKTLSEIIVA
TAKDDSKQGMFNQAAQVWNHTFYWNCMTPTNGGGEPTGDLKGKIEEAFGSYDKFREEFKN
AAMTQFGSGWAWLVADKVGGTLSIAKTANADTPLAHGQVAVLTCDVWEHAYYIDYRNRRP
EYVDTFLDKLVNWDYANAKYQGQDAGVEA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgtcacagattactctaccagaattaccgtacgcaaaaaacgcacttgagccgtacatc
agtgctgaaacgttagaatttcaccatgataaacatcatgctgcgtatgtaaacaaattg
aatgaattgctacctggttctggtctagaagacaaaacgttgtcagaaatcatcgtagcg
actgctaaagatgacagcaaacaaggtatgttcaaccaagcagcgcaagtatggaaccac
acgttctattggaactgcatgacgcctaccaatggcggcggcgaacctactggcgatcta
aaaggcaaaatcgaagaagcctttggtagctatgataaattccgtgaagagttcaaaaac
gcggcaatgactcagtttggttctggttgggcttggctagttgctgataaagttggcggc
acactatcaatcgctaaaacagctaatgctgatacgccattagcacatggtcaagtagct
gtattgacttgtgatgtgtgggaacatgcgtactatatcgactatcgtaaccgtcgtcct
gagtatgttgatacgttcctagacaaactagtgaactgggactacgcaaatgcaaaatat
caaggtcaagatgctggcgttgaagcgtaa

DBGET integrated database retrieval system