KEGG   Psychrobacter urativorans: AOC03_10675Help
Entry
AOC03_10675       CDS       T04087                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pur  Psychrobacter urativorans
Pathway
pur00061  Fatty acid biosynthesis
pur00780  Biotin metabolism
pur01100  Metabolic pathways
pur01212  Fatty acid metabolism
Module
pur_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pur00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AOC03_10675
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AOC03_10675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pur01004]
    AOC03_10675
Enzymes [BR:pur01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AOC03_10675
Lipid biosynthesis proteins [BR:pur01004]
 Fatty acid synthase
  Component type
   AOC03_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: ALF60446
UniProt: A0A0M4T902
LinkDB All DBs
Position
2469473..2469985
Genome map
AA seq 170 aa AA seqDB search
MSAIDIDTLTDEDINALSEQGLTLPLTYHTLKHYLPHRYPFMLVDRITACKPGECITGIK
NVTINEEFFNGHFPDEPIMPGVLMVEAMAQVSGVLGFISAGLTAEDGYLYLFAGVDKVRF
KRRVIPGDQLIIRAKTVMQRHGIYKFDCTVHVEDELAASAQVMIARQEQS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccattgatattgataccctaactgatgaagacatcaacgctttatctgagcaa
ggtttaacgctaccgttaacctatcatacgcttaagcattatctgccgcatcgttatcca
tttatgttagtggatagaattactgcctgtaagccgggtgagtgtattacgggcatcaag
aatgtgactattaatgaagaattctttaatggtcacttccctgatgagccgattatgcca
ggggtattgatggtagaagcgatggcacaagtatccggtgtgttgggctttatcagcgcg
ggtctgacagcagaagatggttatttgtatttattcgcaggcgtcgataaagtacgtttt
aaacgccgcgtgattcctggtgatcagttaatcatccgtgcaaaaaccgtcatgcaacgt
catggtatttataagtttgattgtacagtgcatgtcgaagatgagcttgccgcaagtgct
caagtgatgattgcgcgtcaagagcaatcataa

DBGET integrated database retrieval system