KEGG   Psychrobacter urativorans: AOC03_11820Help
Entry
AOC03_11820       CDS       T04087                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pur  Psychrobacter urativorans
Pathway
pur00010  Glycolysis / Gluconeogenesis
pur00053  Ascorbate and aldarate metabolism
pur00071  Fatty acid degradation
pur00280  Valine, leucine and isoleucine degradation
pur00310  Lysine degradation
pur00330  Arginine and proline metabolism
pur00340  Histidine metabolism
pur00380  Tryptophan metabolism
pur00410  beta-Alanine metabolism
pur00561  Glycerolipid metabolism
pur00620  Pyruvate metabolism
pur00625  Chloroalkane and chloroalkene degradation
pur00903  Limonene and pinene degradation
pur01100  Metabolic pathways
pur01110  Biosynthesis of secondary metabolites
pur01120  Microbial metabolism in diverse environments
pur01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pur00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AOC03_11820
   00053 Ascorbate and aldarate metabolism
    AOC03_11820
   00620 Pyruvate metabolism
    AOC03_11820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOC03_11820
   00561 Glycerolipid metabolism
    AOC03_11820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOC03_11820
   00310 Lysine degradation
    AOC03_11820
   00330 Arginine and proline metabolism
    AOC03_11820
   00340 Histidine metabolism
    AOC03_11820
   00380 Tryptophan metabolism
    AOC03_11820
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOC03_11820
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOC03_11820
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AOC03_11820
Enzymes [BR:pur01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AOC03_11820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ALF60645
UniProt: A0A0M4TEB1
LinkDB All DBs
Position
2782777..2784261
Genome map
AA seq 494 aa AA seqDB search
MTTNNANSNAYSDFHLQYIAGDWKKGDDDSVNIDTNPYNGETLVEIKQATKEQLDEAYQA
ASAAQKQWAQQTPNERAATLYKVVSIFDQRQDEIVDWLIKESGSTRIKAMVEFSSARAIT
LEAASFPNRVHGEIRPSNTPGKENFIYREPMGVIAVISPWNFPLHLTQRSIAPALALGNA
VVLKPASDTPITGGLLLAKIFEEAGLPKGLLNVVVGAGSEIGDAIVTHDIPSLVSFTGST
SVGKHIGELANGGDYIKQVALELGGNSPFVVLKDADIEQAVKAAAFGKFLHQGQICIAIN
RIIVEDEIYDDFVERFLAHVKTLNVGDPSKLDTAVGPIINEKQVKSLKDKIDKTQQQGAK
MILSGEIKGQLVPPHIFTEVTREMDLSCNEVFGPLVGIIRAKDEDDALSIANDSMYGLSS
AVFTEDMAKGLRFARGIKAGMTHINDISVNDESNAPFGGEKNSGIGRFNGEWILEEFTTL
HWISVQHIPRDYPF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactacgaataatgccaactcgaacgcttatagtgattttcatttgcaatatatcgct
ggtgactggaaaaaaggcgatgatgatagcgtcaatatcgataccaatccttataacggc
gagactctggtagagattaaacaggcgacgaaagaacaactggatgaggcttatcaagca
gcaagtgccgctcaaaagcagtgggctcagcaaaccccgaacgaacgggctgctactctt
tataaagtagtcagtatttttgatcagcgtcaagatgaaattgttgattggttgattaaa
gagtcgggcagcacgcgtattaaagccatggttgagtttagcagtgcgcgcgcaattacc
cttgaagccgcaagttttcccaatcgtgtacatggtgagattcgtccgtctaacacaccg
ggtaaagagaactttatctatcgtgagccgatgggtgtgattgcggtgattagcccatgg
aactttcctttacatttaactcagcgttctattgcgcctgctttagcattgggtaatgcc
gtggttctcaagcctgcgagcgatacgccaattacgggcggtttattactcgccaaaata
tttgaagaagcgggcttgccaaaaggtttgcttaatgtggtcgttggtgcaggtagcgag
ataggggacgccattgttacccatgatattccaagtttagtatcatttaccggctcaacg
tcagtgggtaagcatattggtgaattggcaaatggtggcgactatatcaagcaagtggcg
ttagagctgggtggtaatagtcctttcgtagtgttaaaagatgccgatatcgagcaagcg
gtaaaagccgccgcctttggcaagttcttgcatcaaggtcagatttgtattgcgattaac
cgtatcattgtcgaagatgagatttatgatgactttgtcgagcgcttccttgctcacgtt
aagaccttaaatgtcggtgatcctagtaaattggataccgcagtcggtccgattatcaat
gaaaaacaagtgaaatcgcttaaagacaaaatcgataaaacgcagcaacaaggtgcaaaa
atgattttaagtggtgagattaaaggtcaactagtaccgccgcatatctttacggaagtg
acgcgtgagatggacttgtcctgtaatgaagtgttcggacccttggtcggtatcatccgc
gctaaagatgaagacgatgcactgtcgattgccaatgactctatgtatggactatctagc
gcggtctttactgaagatatggcaaaggggttacgctttgctcgcggtatcaaagcaggt
atgactcatattaatgatatctcggtcaatgatgaaagcaatgcgccatttggtggcgag
aaaaattcaggtatcggacgttttaacggtgaatggatacttgaagaatttaccacttta
cattggatttcggttcagcatataccgcgtgattatccattttaa

DBGET integrated database retrieval system