KEGG   Pusillimonas sp. ye3: CKA81_00960Help
Entry
CKA81_00960       CDS       T05795                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pus  Pusillimonas sp. ye3
Pathway
pus00030  Pentose phosphate pathway
pus01100  Metabolic pathways
pus01110  Biosynthesis of secondary metabolites
pus01120  Microbial metabolism in diverse environments
pus01130  Biosynthesis of antibiotics
pus01200  Carbon metabolism
pus01230  Biosynthesis of amino acids
Module
pus_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pus_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CKA81_00960 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CKA81_00960 (tkt)
Enzymes [BR:pus01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CKA81_00960 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: QAA92568
UniProt: A0A410G8B4
LinkDB All DBs
Position
200254..202299
Genome map
AA seq 681 aa AA seqDB search
MSLTPAQDSSMANAIRALSMDAVQQANSGHPGAPMGMADIAEVLWTRHLRHNPSDPAWAN
RDRFVLSNGHGSMLIYALLHLTGYDLPIEELRNFRKLHSRTPGHPEVGITAGVETTTGPL
GQGLANAVGMALSEALLAEEFNRQGHAVVDHYTYAFVGDGCLMEGISHEVCSLAGTLKLS
KLIVFYDDNGISIDGRVENWFGDDTPTRFKSYGWNVLPGVDGHDSQAVDRAIAQAKDLAA
QGKGPTLICCRTVIGKGAPNAAGSEKVHGAALGAAEIEATRVALNWPHAAFEIPADIYAH
WDAKQQGQQQQAEWQTRFDAYAQAFPTEAAELQRRMAGDLPADFAERSVAFIEATSQKAE
TVASRKASQLAITALVEMLPEMLGGSADLTGSNLTDWKGAQAVRAGQPQLQFGRHINYGV
REFGMAAIMNGVALHGGYLPFGGTFLTFSDYSRNALRMAALMKQRVVHVFTHDSIGLGED
GPTHQSVEHAASLRLIPNLHVWRPCDTTETAVAWVCAIQRPVSVGMTVRDGGPSALLLSR
QNLPFVDRDADTIAAIQRGGYVLRDAKDAKAVIIATGSEVGLALAAQEQLAQQGVAVRVV
SMPCTNVFDAQDAQWREAVLPKGLPRVAVEAGVTAGWYKYVGLDGAVVGLDTYGESAPAG
DLFTYFGLTAERVAAAVEQVL
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgagccttacgcctgcccaagattcgtccatggccaacgccatacgtgcgctttccatg
gacgcagttcaacaagccaactcggggcatcccggggcgcccatgggcatggcagacatc
gccgaggtcctctggacccggcatctgcggcacaatccgtccgaccccgcatgggccaac
cgcgaccgcttcgtgttgtccaacggccacggatccatgctgatctacgccttgctgcat
cttaccggctacgacctgcctatcgaagagctccgcaatttccgcaaattgcattcacgt
acccccgggcaccccgaggtgggtattaccgcaggtgtagagaccaccaccgggccgctg
ggccaggggctggccaatgcggtgggcatggccttgagcgaagccttgctggcggaagag
ttcaatcgccagggccacgccgtggtcgaccactacacctatgccttcgtgggcgatggt
tgcctgatggaaggcatttcgcacgaagtttgctcgctggccggtacgctcaagctgtcc
aagctgatcgtgttttacgacgacaacggcatttccattgacggccgcgtcgagaactgg
ttcggcgacgatacgcccacgcgcttcaagagctatggctggaacgtcctgcccggcgtg
gacggtcacgatagccaggctgtggatcgcgccatcgctcaggcgaaagacctggcagcc
cagggcaagggccccacactgatctgctgtcgcaccgtgatcggcaagggcgcgcccaat
gccgccggcagcgagaaggtccatggcgccgccttgggcgccgcggaaatcgaggctacc
cgtgtagcgctgaactggcctcatgcagccttcgagatcccggccgacatctatgcacac
tgggacgccaaacagcaagggcagcaacagcaagccgaatggcaaacgcgcttcgacgcc
tacgcgcaggccttcccgaccgaagccgccgaactgcaacgccgcatggccggcgacttg
cccgctgactttgccgagcgtagcgtcgccttcatcgaggccaccagccaaaaggccgaa
accgtcgccagccgcaaggcttcccagttggccatcaccgccttggtcgagatgctgccc
gaaatgctgggcggatcggccgacctgaccggatcaaaccttaccgactggaagggggcg
caggccgttcgtgcgggacagccgcaactgcagtttgggcgccacatcaactacggcgtg
cgcgagttcggcatggctgccatcatgaacggcgtggcgctgcatggcggctacctgcct
ttcggcggcaccttcctgaccttttccgactactcgcgcaatgccctgcgcatggcggcg
cttatgaagcaacgggtggtgcatgtattcacgcacgactccatcggcctgggcgaagac
ggccccacccaccagtcggtcgagcatgccgccagcttgcgcctgatacccaacctgcat
gtgtggcgcccttgcgatacgaccgaaaccgccgtcgcatgggtttgcgccatccagcgg
cccgtcagcgtgggcatgaccgtgcgcgacggtggcccatcggcattgctgctgtcgcgg
caaaatctgccatttgttgaccgcgacgccgatacgatcgcagccatccagcgtggcggc
tatgtattgcgcgacgccaaagatgccaaggcggtaatcattgccaccggctcggaagtc
ggcttggccctggctgcacaagaacaactggcgcaacagggcgtggcggtgcgggtcgtg
tccatgccttgcaccaatgtcttcgacgcgcaggacgctcagtggcgcgaagccgtcttg
cccaagggcctgccgcgtgtagcggtggaggccggcgtaactgccggctggtacaagtat
gttggtctggacggtgcagtggttggtctggacacttatggcgaatcggccccggctggc
gatttgttcacgtattttggcttgactgccgagcgcgttgctgcggccgtcgaacaggtt
ttataa

DBGET integrated database retrieval system