KEGG   Pusillimonas sp. ye3: CKA81_02910Help
Entry
CKA81_02910       CDS       T05795                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pus  Pusillimonas sp. ye3
Pathway
pus00564  Glycerophospholipid metabolism
pus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pus00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CKA81_02910
Enzymes [BR:pus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CKA81_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 HI0933_like GIDA Lycopene_cycl Thi4 NAD_binding_8 Trp_halogenase Pyr_redox_3 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: QAA95435
UniProt: A0A451FSJ5
LinkDB All DBs
Position
599440..601032
Genome map
AA seq 530 aa AA seqDB search
MTTPASPQPSDRSKLLAALGGLGKVDVAIIGGGATGLGVALDAATRGLSVVLLESHDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERSNLLHNAPHLARPLPFVMPSYKCWETPF
YGIGLKAYDALAGKAGLGPTEFLGSRQAQRCIPGVKTAGLKGGVKYWDGQFDDARLAMAL
ARTAAEQGALLLNYCPVTDLIHEDGKVAGLRCSDTETGAQYTVQARCVVNATGVWVDGIR
EKDGTATGRKTQPMVAPSQGVHLVVDSDFFPGDHAMLVPKTQDGRVLFAVPWLGKVILGT
TDTPRHDLSLEPEAFAEEVNFILGEAAKYLQRAPTRNDVRSIWVGLRPLVRPPRNEGDKT
QQISREHTVLVSPSGLVTVTGGKWTTYRAMAEDVLEKCVAGGLLDRLPPAETADFMLVGA
SETSVRASITAQPGLDAYGTEADIVRAMPGNDTELTPGLTVGMLRFAARYEYARCVEDVL
ARRSRLLFLDAGLAARLAPAVAAVLLEETGMDPRLSEFLALADHYQAVPG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactactcctgcatctccacagccgtccgatcggtcgaagttattggccgcgctcggc
ggcctgggcaaggtcgatgtggccatcatcggtggcggcgccactggcctgggcgtagcc
ctggatgccgcgacgcgcgggctatcggtggtgttgctcgaatcccatgatttcgccaag
ggcacctcgtcccgggccaccaagctggttcatggcggtgtgcgctacctggctcaggga
aacatcgcgctggtgcgcgaagcgctgcacgaacgctccaacctattgcataacgcgccg
cacttggcgcgacccctgccttttgtgatgcccagctacaaatgctgggaaacgccgttc
tacggcatcggcctgaaagcctatgatgccctggccggtaaggccggcctgggccctacc
gagttcctgggcagccgccaggcgcaacgatgcatacccggcgtcaagaccgccggcctt
aaaggcggcgtcaagtattgggatggccagtttgacgatgcgcggctggccatggcgctg
gcgcgcacggcagcggagcagggcgccttgctgctcaactattgcccggttacggatttg
attcatgaagacggcaaggtggccggcttgcgctgtagcgataccgaaaccggcgcccag
tacaccgtgcaggcgcgctgcgtggtcaatgccaccggcgtctgggtagacggcatacgc
gagaaagacggtacggccaccggccgcaagacccagcccatggtggcgcccagccaaggg
gtgcacctggtggttgacagcgatttctttccgggtgaccacgccatgctggttcccaag
acgcaggatggccgtgtcctgtttgccgtgccctggttgggcaaggtaatacttggtacc
accgacacgccgcgccacgacttgtccctcgaaccggaagctttcgctgaagaagttaac
ttcatactgggtgaggcggcgaagtatttgcagcgggcacctacccgcaacgacgtgcgc
agcatttgggtcggcttgcgaccgttggtccggccgccgcgcaacgaaggcgacaagact
cagcagatcagccgtgaacatacggtgttggtaagtcctagcggtttagtgacggttacc
ggtggaaaatggaccacttaccgggcgatggccgaagatgtcctggaaaagtgtgttgcc
ggcggtttgctggaccgcctgccacccgccgaaacggctgacttcatgctggtcggcgcc
tcggaaacctccgtgcgagcctccatcacggcacagcccggcctggacgcctatggcacc
gaggccgatatcgtaagggccatgcctggaaacgataccgagcttacgcccggtttgacg
gtcggcatgctgcgatttgccgcgcgttacgaatatgcccgttgcgtcgaagacgtgctg
gcgcggcgctcgcgcttgctgttcctggatgccgggctggcggcccggttggcgccggcg
gttgcggccgttttgctggaggaaacgggcatggacccccggttgtccgaatttctggcc
ctggctgaccactatcaggcggtgcccggctga

DBGET integrated database retrieval system