KEGG   Pusillimonas sp. T7-7: PT7_0014Help
Entry
PT7_0014          CDS       T01486                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00473  D-Alanine metabolism
put00550  Peptidoglycan biosynthesis
put01100  Metabolic pathways
put01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PT7_0014
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PT7_0014
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PT7_0014
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:put01011]
    PT7_0014
Enzymes [BR:put01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PT7_0014
Peptidoglycan biosynthesis and degradation proteins [BR:put01011]
 Precursor biosynthesis
  Amino acid ligase
   PT7_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATPgrasp_ST TTL ATP-grasp ATPgrasp_YheCD CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEC18554
UniProt: F4GTU5
LinkDB All DBs
Position
17707..18654
Genome map
AA seq 315 aa AA seqDB search
MNGTYGRVGVLYGGRSAEREVSLMSGQGVFEALRSVGVDAHLFDTGRYTLVDLINAGFDR
VFIALHGRYGEDGTLQGALELMGLPYTGSGTLASSLAMDKIMTKQVWLQQGLPTPRYAIL
RPDTDLASVAAVLDLPLIIKPPHEGSTLGVTKVDGLDSLREAYQLAARYDADVLAEQFIV
GRELTVALLGGGGSARALPVIEIVAPDGNYDYEHKYISNDTQYICPAKLDDALSASIRQI
AEQAYVALGCEGWGRADFMLDEAGKPWLLEINTSPGMTSHSLVPMAAKADGMSYAELCLE
ILSTASCKVLTPPAA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaacgtatggccgtgtaggtgttttgtatggaggccgttctgccgagcgggag
gtctccctgatgtcgggccaaggcgtgttcgaggcattgcgcagcgtgggtgttgacgcg
catttgtttgacacggggcgctacacccttgtcgacctgatcaacgccggcttcgaccgt
gtatttattgcgctgcacgggcgttatggcgaagacggtacgctgcaaggcgcactggaa
ttgatggggctgccttataccggcagcggcactctggcttcatcgctggccatggacaaa
atcatgaccaagcaggtgtggttgcagcaaggtctgcctaccccccggtacgccatcctg
aggccggacaccgatctggcatcggttgcggccgtgttggatttgccgctgatcatcaag
ccgccccatgaaggctctacgctgggtgtgaccaaggtcgacgggctggacagcttgcgc
gaggcttatcagttggccgccagatacgatgcagacgtgttggcagagcagttcatagtg
ggccgtgagttgactgtagccttgctgggcggaggcgggtcggcacgggcgctgccagtg
attgagatcgtggcgcctgatggcaactacgactatgagcacaaatatatatccaacgac
acccaatacatatgtccggcaaagctggatgacgccctgagcgcatccatacgccagatt
gccgagcaggcctatgttgcgctcggttgtgaaggctggggccgcgccgatttcatgctg
gatgaggcaggcaagccgtggctgttggaaatcaatacttcaccgggaatgaccagccat
tcgctggttcccatggcggccaaggcagatggtatgagctacgccgagttgtgcctcgaa
attttgtcaacggccagctgcaaagtgctgacgccacccgcggcctga

DBGET integrated database retrieval system