KEGG   Pusillimonas sp. T7-7: PT7_0153Help
Entry
PT7_0153          CDS       T01486                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
put  Pusillimonas sp. T7-7
Brite
KEGG Orthology (KO) [BR:put00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PT7_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE FUSC_2
Motif
Other DBs
NCBI-ProteinID: AEC18693
UniProt: F4GV51
LinkDB All DBs
Position
complement(174884..175621)
Genome map
AA seq 245 aa AA seqDB search
MSIASLLAVVLAGFLIGATGIGGVLLVPVLTGMGGIDAAHAIAASSLAFGFPGIAALWYL
NQDRERMREAMPVVIGTVPGAALGAVLVHSLDSRFVLVLVTVTIFFAGLRGLFGNRAVIE
ETIKPPITRGGLAGIGLLAGVGSALTGTGGPVLLIPLLMLLHQPLRLAIVTGQTVQLPIA
LAAIAVHARAGSLDWMLGGALGVILLLASLAGQWAARRMQVKLLQTALSVFLLLIGIWFT
YLLFP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgctagcctgctcgccgtcgtacttgcgggttttctgattggcgcgacaggt
atcggcggtgtattgctggtgccagttctgacaggcatgggcggaatcgatgcagcacat
gccattgccgcatcctctttggcctttgggtttcccggtatcgccgccttgtggtatctc
aatcaagaccgagagcgcatgcgcgaggccatgcctgtggtgattggaaccgttcctggc
gctgcgctgggcgccgtcctggtgcacagcttggattcccgcttcgtgcttgtactggtc
accgtcaccattttcttcgccggtttgcgtggcctgtttggcaacagagccgtcatagaa
gaaaccatcaagccgcctatcaccaggggtgggttggccggcattggccttcttgctggt
gtcggctcagcacttaccggcacgggcggaccggttttgttgattccattgctgatgctt
ttgcatcaaccccttcgcttggcgattgtgacgggacagactgtacagctacccatcgcc
ttagcggcgattgccgtgcatgcgcgtgccggcagcctggattggatgcttggcggcgcc
ttgggcgtgatattgctgctagcctctttggctggtcaatgggcagcgcgacgaatgcag
gtcaagctgctgcaaacagcgctctctgtgttccttttgcttataggcatctggtttact
tacttgctttttccctaa

DBGET integrated database retrieval system