KEGG   Pusillimonas sp. T7-7: PT7_0422Help
Entry
PT7_0422          CDS       T01486                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00020  Citrate cycle (TCA cycle)
put00190  Oxidative phosphorylation
put00650  Butanoate metabolism
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01120  Microbial metabolism in diverse environments
put01130  Biosynthesis of antibiotics
put01200  Carbon metabolism
Module
put_M00009  Citrate cycle (TCA cycle, Krebs cycle)
put_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
put_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PT7_0422
   00650 Butanoate metabolism
    PT7_0422
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PT7_0422
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PT7_0422
    1.3.5.4  fumarate reductase (quinol)
     PT7_0422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like Thi4 FAD_binding_3 Lycopene_cycl Pyr_redox_3 NAD_binding_7 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEC18962
UniProt: F4GX97
LinkDB All DBs
Position
489098..490873
Genome map
AA seq 591 aa AA seqDB search
MAAVKNSLPRRQFDVVVVGAGGAGMRCSLQLAQAGLSVAVLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNADGTIY
QRPFGGHTANFGEKPVQRACAAADRTGHAMLHTLYQRNVAARTQFFVEWMALDLLRNEAG
DVLGVTALEMETGEIYVLEAKQTVLATGGAGRIWAASTNAFINTGDGLGMAARAGLPLQD
LEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGDGSYVVLKLDHLGAETIQKRLPSIREIAIKFANVDPIKDPIPVVPTIHYQM
GGVPTNIYGQVVSYANGETTPVNGLYAIGECAATSVHGANRLGTNSLLDLIVFGRSAGNH
IVGTHPERQHAHQPIPESAIDYSLDRVNKIESRTSGEKTQDVANAMRVSMQHHCGVFRTL
DLLAKGVDAIEDIAQQVDNIYFKDKSKVFNTARVEALEVSNMIEVAKATTKSAANRTESR
GAHALSDHPERDDENWLRHTLWFSEGSRLEYKPVTMKPLTVDSFPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggctgctgtcaaaaattccttaccacgccgccagtttgatgtggtggtcgttggcgcc
ggcggggccggcatgcgttgctcattgcaactggcgcaggccggcctgtcggtcgctgta
ttgtccaaagttttccccacgcgttcgcatacggtggcggctcagggcggcgtcagcgct
tccctgggcaacatgagcgaagacaactggtattggcatatgtacgataccgtcaagggt
tccgactggctcggcgaccaggacgctatcgaattcatgtgccgcgaagcacccaatgcg
gtctacgaactcgaacactttggcatgccgttcgaccgtaatgccgatggtacgatttac
cagcgtccgtttggcggccatacggccaacttcggcgaaaaaccagtacaacgcgcctgt
gccgcggccgaccgtaccggtcatgccatgcttcataccctgtaccagcgcaacgtggca
gctcgtacgcagttctttgtcgaatggatggccctcgacttgctgcgcaacgaagccggc
gacgtcctgggtgtgaccgcgctcgaaatggaaaccggcgaaatctacgtcctggaagcc
aagcagaccgtcctggctactggcggtgcgggccgtatctgggcagcgtccaccaatgcc
ttcatcaacaccggcgacggcttgggtatggccgcgcgtgcaggactgcctttgcaggat
ctcgagttctggcaattccaccccactggcgtagccggtgctggcgtactcatcaccgaa
ggcgtacggggcgagggcggtatcctgctcaataaagatggcgagcgcttcatggagcgc
tatgcacccacgctcaaagacttggcgccacgcgacttcgtatcgcgctcgatggaccag
gaaatcaaagaaggccgtggttgtggcgacggcagctacgtagtgctcaagctggatcac
ctgggggctgaaaccatacagaagcgtctgccttccattcgtgaaatcgccatcaagttc
gccaacgtcgatcccatcaaggacccgatcccggtcgtacctacgatccactaccagatg
ggtggcgttcccaccaacatctatggtcaggtcgtcagttacgccaatggcgaaaccacg
ccggtcaacggcctgtacgccatcggcgaatgcgcggccacgtcggtgcatggcgccaac
cgcctgggcaccaactcgctgctcgaccttattgtgtttggccgttcggcaggcaatcac
attgtcggcacgcaccccgagcgtcagcatgcccatcagcccattcctgaatcggctatc
gattattcgctggatcgcgtcaacaagatcgaatcgcgtacttcgggcgagaaaacgcaa
gacgtcgccaatgccatgcgtgtttccatgcagcaccattgcggcgtattccgcacgctc
gatctcttggccaagggtgtcgacgccatcgaagacattgcccagcaagtagacaacatc
tacttcaaggataagtccaaggtcttcaatacggcccgtgtcgaggcgcttgaggtctcc
aacatgatcgaagtggccaaggcaacgaccaagtcggcagccaatcgcactgaaagccgt
ggcgcgcatgcgcttagcgatcatcccgagcgtgacgacgaaaactggctgcgccatacc
ttgtggttctcggaaggcagccgtctcgaatacaagccggtcaccatgaagccgcttacc
gtagatagcttcccgcccaaagcgcggaccttctaa

DBGET integrated database retrieval system