KEGG   Pusillimonas sp. T7-7: PT7_1741Help
Entry
PT7_1741          CDS       T01486                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
put  Pusillimonas sp. T7-7
Pathway
put03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:put00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    PT7_1741
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:put03400]
    PT7_1741
Enzymes [BR:put01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     PT7_1741
DNA repair and recombination proteins [BR:put03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     PT7_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG AbiEi_3_N
Motif
Other DBs
NCBI-ProteinID: AEC20281
UniProt: F4GMI7
LinkDB All DBs
Position
complement(1859915..1860775)
Genome map
AA seq 286 aa AA seqDB search
MMHNMQTQAPRLSRLQEAWLQEIGLDRRMLAHYAATPAAAPVVAPVLERDGQPQPQPTGS
GLQATRELLRTPPQPKAKQPAPESPEMPRLPVPETWEALISHIAGCQACGLHVGRSHAVS
GAGAEHMPEWLVVGEAPGSVDDRTGLPFQGKAGQLLQAMLASIQVTEQTPVFFTNVIKCR
PLGNRTPTQDEIEACMPYLQRQIALLKPHRILALGSLAAQAVLGLQNDLEALRGKVHAMR
SEADQDIPVVVTYHPTALLLRPQHKPDAWRDLNLARTLLAVGAGGA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacaacatgcaaacccaagcgccgcgtttgagccgcctgcaagaagcctggcta
caggaaatcgggctggacaggcgcatgctggcgcactatgccgctacgccggcagctgcg
cccgttgtggcgccggtgcttgagcgcgacgggcagccgcaaccgcagccgacaggcagt
ggtctgcaagccacccgcgaactgctccgtacaccaccacagcccaaagccaaacagccg
gcgccagaatctcctgagatgccccgccttccggtgcccgaaacctgggaagcattgatt
tcacatattgccggatgccaggcatgtgggctgcatgtggggcgcagccacgcggtttct
ggtgctggggccgagcacatgcccgagtggttggtggttggcgaggcgcccggcagtgtc
gacgatcgcacaggcctgccgtttcagggcaaggccggccagcttttacaggccatgttg
gcctctattcaggtcactgagcagactccggtttttttcactaacgtgatcaaatgcagg
cctttgggcaaccgcacgcccactcaagatgaaatcgaagcatgcatgccttatttgcag
cgtcagattgctttgttgaaaccgcacagaattcttgctctgggcagccttgcggcacag
gctgtactgggtttgcagaacgacctggaggccttgcgcggcaaggtgcatgccatgcgc
agcgaggccgaccaggatatcccggtggtcgttacttatcatccgacagcgctgctgctg
cgccctcagcacaaaccggatgcatggcgggatttgaatttggcgcgtaccttgctggcg
gtgggagccggcggcgcttaa

DBGET integrated database retrieval system