KEGG   Pusillimonas sp. T7-7: PT7_2851Help
Entry
PT7_2851          CDS       T01486                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
put  Pusillimonas sp. T7-7
Pathway
put00400  Phenylalanine, tyrosine and tryptophan biosynthesis
put01100  Metabolic pathways
put01110  Biosynthesis of secondary metabolites
put01130  Biosynthesis of antibiotics
put01230  Biosynthesis of amino acids
Module
put_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:put00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PT7_2851
Enzymes [BR:put01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PT7_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_16 AAA_33 TsaE APS_kinase AAA AAA_5 Ploopntkinase3 Cytidylate_kin2 AAA_22 CbiA
Motif
Other DBs
NCBI-ProteinID: AEC21391
UniProt: F4GX03
LinkDB All DBs
Position
complement(3017783..3018379)
Genome map
AA seq 198 aa AA seqDB search
MNDSLPFGSAGLPNKDQPNTKPLGYDTPIFLIGMMGAGKTTIGRHLARILDRDFVDLDHQ
LEARCGVRVSLIFDIEGEEGFRKRESVALDECSQRCNIVLATGGGAVLASENQRYLKERG
VVVYLRATAEELFRRVARDRSRPLLQTPDPQARIRELLTQREPIYESLADLTLETGSTPA
AQIVRVLVSMLQQHEVQS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattctttacctttcgggtctgccggattacccaataaagaccagcctaataca
aagccgctgggctacgatacaccgattttcctgataggcatgatgggagccggaaaaacg
accataggccgccatctggcacgcatactggatcgcgattttgtcgatctggatcatcag
ctcgaggctcgctgcggtgtccgcgtgtcgttgatattcgacatcgagggggaagaaggg
ttccgtaaacgcgaatcggttgccttggacgagtgctctcaacgttgcaatattgtactg
gccaccggaggcggcgcggtgcttgccagtgaaaaccagcgttatctgaaagagcgtggc
gtggtcgtatacttgcgggcgacggcagaagagctgtttcgtcgcgtggcgcgcgaccgc
agccgcccactgctgcaaacgcccgacccgcaggcccgtatccgtgaattgctgacgcag
cgcgaacccatatacgaaagcctggccgacctgacgcttgaaaccgggagtacgcctgct
gcgcaaattgtgcgtgtgctggtctctatgctgcaacaacacgaggtgcaatcatga

DBGET integrated database retrieval system