KEGG   Pusillimonas sp. T7-7: PT7_3659Help
Entry
PT7_3659          CDS       T01486                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
put  Pusillimonas sp. T7-7
Brite
KEGG Orthology (KO) [BR:put00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PT7_3659
Enzymes [BR:put01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PT7_3659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 FAD_binding_3 HI0933_like DAO AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin Lycopene_cycl FMO-like K_oxygenase NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AEC22199
UniProt: F4GT87
LinkDB All DBs
Position
3843300..3844898
Genome map
AA seq 532 aa AA seqDB search
MLDANLKTQLKSYMEMVSQPIEIVACLDDGAKSRELRELLQEIEGMSDKISLTERNDSDE
RKPSFTINRSGTDISVRFAGIPMGHEFTSLVLALLQVGGHAIKLDESVIEQIRNLDGDFK
FETYFSLSCQNCPDVVQALNVMSIINPRIQHVAIDGALFQDEVDARQIMSVPTMFLNGEV
FGQGRSSVEEILARLDTGAAARRAEEISAKEAYDVLIVGGGPAGAAAAVYAARKGIRTGI
VAERFGGQVLDTMAIENFISVKETEGPKFAAALEQHVKDYDVDIMNLQKAQALVPGKGLT
EVRLADGGVVKGKTVILATGARWREINVPGEREYRNNGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGLVAHVTLIEFGDALRADAVLQRKLRSLSNVTVIMSAQTTEIHGDGKK
VNGLSYKDRTTGETLKVELEGVFVQIGLVPNTEWLKDTLALSRHGEIEIDAKGKTSLPGV
FAAGDCTTVPYKQIVISAGDGAKAALSAFDHLIRTSVSDVDETETVLETVSA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcaaatcttaaaacccagttgaaatcctatatggaaatggtctcgcaaccc
atcgagatcgtggcgtgcctggacgatggcgccaagtcccgtgaattgcgtgaactgctc
caggaaatcgaagggatgtcggacaagatttcgctgaccgaacgtaacgacagcgacgag
cgcaagccatcgttcaccatcaaccgcagcggcaccgacatcagtgtgcgctttgcgggc
atccccatgggtcacgaatttacatcgctggtgctggcattgctgcaagttggcggccat
gccatcaagctggacgagtccgtgatcgaacaaattcgcaatcttgatggcgacttcaag
tttgaaacctatttttccttgtcctgccagaactgccctgacgtggttcaggcactgaac
gtcatgtccatcatcaacccgcgtattcagcacgtggccatcgatggcgccttgttccag
gacgaagtcgacgcgcgacaaatcatgtctgtgccgaccatgttcctgaatggcgaagtg
ttcgggcaaggccgctccagcgtcgaggaaatcctggccaggctggatactggcgccgca
gcacgccgggctgaagaaatcagcgccaaggaagcctacgatgtactgattgtcggtggc
ggtcccgccggcgcggcggcagccgtttatgccgctcgcaagggcatacgcacaggtatc
gtggctgaacgttttggcgggcaggtgctcgacaccatggccatcgaaaacttcatttcg
gtgaaagaaactgaagggcccaagttcgcggcagcgctggagcagcacgtcaaggattac
gacgttgacatcatgaacctgcaaaaggcccaggcgctggtgcctggcaagggcttgacc
gaagtccgtctggccgatggcggtgtcgtgaaaggcaagactgtcattctggcaaccggc
gcgcgctggcgcgaaatcaacgtgcccggcgagcgcgaataccgcaacaacggtgtggcc
tactgcccgcactgcgatggtcctttgttcaagggcaagcgtgtggcagttattggcggt
ggcaactccggtgttgaagcggccattgatctggccggcctggtcgcgcatgtaacgctt
attgagtttggcgatgccttgcgtgccgatgccgtgttgcagcgcaagctgcgcagcctg
tccaacgtgaccgtcatcatgtcggcccaaaccaccgaaatccatggcgatggcaagaag
gtcaatggtctgtcttataaagaccggaccactggcgaaacgcttaaagtcgaactggag
ggtgttttcgtccagatcggtctggtgcccaataccgaatggctgaaagacacgctggcc
ttgtcgcgtcatggtgaaatcgaaatcgacgccaaggggaagacctccttgcccggcgta
tttgccgccggcgattgcaccaccgtgccttacaagcagatcgtgatttcggctggcgac
ggcgccaaggcggcgctcagtgcctttgatcatctgatacgcacttcggtgtcggatgtt
gacgaaaccgagacagttcttgaaaccgtgtcagcctga

DBGET integrated database retrieval system