KEGG   Pantoea vagans C9-1: Pvag_0123Help
Entry
Pvag_0123         CDS       T01326                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00473  D-Alanine metabolism
pva00550  Peptidoglycan biosynthesis
pva01100  Metabolic pathways
pva01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pvag_0123 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pvag_0123 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Pvag_0123 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pva01011]
    Pvag_0123 (ddlB)
Enzymes [BR:pva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Pvag_0123 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:pva01011]
 Precursor biosynthesis
  Amino acid ligase
   Pvag_0123 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATPgrasp_Ter ATP-grasp_3 TTL
Motif
Other DBs
NCBI-ProteinID: ADO08343
UniProt: E1SD93
LinkDB All DBs
Position
138479..139399
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLMGGTSAEREVSLNSGQAVVAGLREMGINAHGVDTRDVSVLTLKEQGFTKAFI
ALHGRGGEDGTMQAVLEFLQLPYTGSGVMASAVTMDKLRTKLLWQGRGLPSGKFVWLTRQ
QFDAGLDAESNAAIAALGLPLFVKPACEGSSVGISRVNDLSALPAALDMAFKHDDDVLVE
AFLSGAEYTVAIVGDRILPSIEIKSASEFYDYEAKYISDDTQYVCPADLSAEREAELQQL
VLAAWRALGCRGWGRVDVMTDGEGRFQLLEANTSPGMTSHSLVPMAAKQAGMSFPQLVAH
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcggataaagttgccgtattaatgggcggcacctcagcagagcgtgaggtttcgctg
aactcaggtcaggccgtcgtcgccggactgcgggaaatgggcatcaatgcgcatggcgtc
gatacccgtgatgtgtcggtgctgacactgaaagagcagggctttaccaaagcctttatc
gcgctgcatggccggggcggagaagatggcacgatgcaggcggtgctggagttcctgcaa
ctgccttacaccggcagcggcgtaatggcatcggctgtgaccatggataagctgcgcacc
aaactgctgtggcagggtcgcggattaccctcaggcaaatttgtctggctgacgcgtcag
cagtttgatgccgggctggatgcagagagcaacgcagcaattgcggcgctgggtctgcca
ctgtttgtaaagccagcctgtgaaggctcgagtgtgggtatcagccgggttaacgatctg
agcgcgctgcctgccgcactggacatggcgtttaagcacgacgatgacgtactggtcgag
gcgtttctcagcggcgcggagtataccgtcgcgattgtgggcgatcgtattctgccctca
attgaaataaagagcgccagtgagttctatgactatgaagctaaatacatttctgacgat
actcagtacgtctgtccggccgatttgagcgctgaacgtgaagctgaattacagcagctg
gtgctggcggcctggcgtgcactgggctgtcgtggctggggacgggttgatgtgatgacg
gatggggaagggcgctttcagttgctggaagccaatacctctccgggcatgaccagccac
agtctggttcctatggctgcgaaacaggcgggcatgagtttcccgcagctggttgcccat
attctggagctggccgactga

DBGET integrated database retrieval system