KEGG   Pantoea vagans C9-1: Pvag_0896Help
Entry
Pvag_0896         CDS       T01326                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl ACP synthase
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00061  Fatty acid biosynthesis
pva00780  Biotin metabolism
pva01100  Metabolic pathways
pva01212  Fatty acid metabolism
Module
pva_M00083  Fatty acid biosynthesis, elongation
pva_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pvag_0896 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Pvag_0896 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pva01004]
    Pvag_0896 (fabF)
Enzymes [BR:pva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     Pvag_0896 (fabF)
Lipid biosynthesis proteins [BR:pva01004]
 Fatty acid synthase
  Component type
   Pvag_0896 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ADO09093
UniProt: E1SJP2
LinkDB All DBs
Position
933347..934588
Genome map
AA seq 413 aa AA seqDB search
MSKRRVVVTGLGMLSPVGNTVESTWSALLAGQSGITLIDHFDTSAYATRFAGLVRDFNCD
EYISRKDQRKMDAFIQYGIVAGMQAMQDSGLVITDENASRMGAAIGSGIGGLGLIEENHT
SLVNGGPRKISPFFVPSTIVNMVAGHLSIMYGLKGPSISIATACTSGVHNIGHAARIIAY
NDADVMLAGGTEKASTPLGVGGFGAARALSTRNDNPQAASRPWDKDRDGFVLGDGAGIVV
LEEYEHAKKRGAKIYAEIVGFGMSSDAYHMTSPPEDGSGAAAAMINALRDAQLTPEQIGY
VNAHGTSTPAGDKAEAQAVKSVFGAAASSVMVSSTKSMTGHLLGAAGAVESIYSILALRD
QAVPPTINLDNPDEGCDLDFVPHTARQVPGLEYTLCNSFGFGGTNGSLIFRKV
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaagcgtcgtgtagttgtgactggtcttggcatgttgtctcctgtcggcaatacc
gtagagtctacctggagtgctctccttgccggtcagagcggcattaccctgatcgaccat
tttgataccagtgcttatgcaacccgttttgcaggtctggtaagagattttaattgtgat
gaatacatctcgcgcaaagatcagcgcaagatggatgccttcatccagtacggcattgtg
gccggtatgcaggccatgcaggacagcggtctggttattaccgatgaaaatgcaagccgt
atgggcgcagcaattggctccggcataggtggcttaggtctgattgaagagaatcatacc
tcactggtcaacggcggcccgcgtaaaatcagcccattctttgtgccttcaaccatcgtt
aacatggtggcgggtcatctcagcatcatgtatggcctgaaaggtccaagcatctctatc
gcgacagcctgtacctctggtgtgcataacatcggtcatgccgcacgtatcatcgcctat
aacgatgctgacgtgatgctggcgggtggcacagagaaagccagcacgccattaggcgtc
ggtggttttggtgcagcacgcgccctctcgacccgtaacgacaacccgcaagcggccagc
cgtccgtgggataaagatcgtgatggttttgtgctgggtgacggcgctggcattgtggta
ctcgaagagtacgaacatgcgaagaaacgtggtgcgaaaatctacgcagaaatcgtaggt
ttcggtatgagcagcgatgcctaccacatgacgtcaccaccagaagatggttcgggtgca
gcggcggcaatgatcaatgcgctgcgtgatgctcagcttacgccagagcagatcggctat
gtcaacgcacacggcacctccacgccagccggtgataaagctgaagcgcaggcggtgaaa
tcggtctttggggcagcagccagcagcgtcatggtcagctcaaccaaatcaatgaccgga
cacttactgggtgccgcaggtgcggtagaatcgatttactcgattctggcactgcgcgac
caggccgttccaccgaccattaacctggacaatccggatgagggctgcgatctcgacttc
gtgccgcacaccgcgcgtcaggttcctggactggagtacacgctgtgtaactccttcggt
ttcggcggaaccaacggttcgttgatcttccgtaaagtgtaa

DBGET integrated database retrieval system