KEGG   Pantoea vagans C9-1: Pvag_1228Help
Entry
Pvag_1228         CDS       T01326                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pvag_1228 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pva02000]
    Pvag_1228 (gst)
Enzymes [BR:pva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pvag_1228 (gst)
Transporters [BR:pva02000]
 Other Transporters
  Pores ion channels [TC:1]
   Pvag_1228 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: ADO09418
UniProt: E1SBU9
LinkDB All DBs
Position
complement(1290443..1291048)
Genome map
AA seq 201 aa AA seqDB search
MKLFCKAGACSLSPHIVMRECGLDFTQVSVDLATKLTERGDDFRQINPKGQVPALQLSDG
SVLTEGVAIVQYLADLKPDRHLLAPVGSLTRYHTVEWLSYISSELHKSFGPLFRPGYSDE
VKAQTRSQLEAKFRYVDASLRDRQWLMGLHFSVADAYLFVVTRWAKALGLDLSGFTALEA
WFDRVAERPAVQAALKAEGLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttgcaaagcaggagcctgctctctttctccccacattgttatgcgcgaa
tgcgggctggacttcacgcaggtgagtgttgatctggccacaaaactcactgaacggggc
gatgattttcgccagattaaccctaaaggccaggtgcccgcgctgcagctcagcgacggc
tccgtgctgacggaaggtgttgccattgtgcagtacctggcagatctcaagcccgatcgc
catctgctggcaccggtcggcagcctgacgcgttatcacaccgtggagtggctcagctac
atcagcagcgaactgcacaaaagctttgggccgctgttccgtcccggttactccgatgag
gtgaaagcacagacgcgcagccagctggaagcgaaattccgctatgtcgatgcgtcactg
cgcgacagacagtggctgatggggctgcatttcagcgtggcggatgcctatctgtttgtg
gtgacgcgctgggcaaaagcgctgggactggatctgtccggctttacggcgctggaggcg
tggtttgatcgcgttgccgagcgtcctgcggtgcaggcggcgctgaaagcggaaggctta
gcctga

DBGET integrated database retrieval system