KEGG   Pantoea vagans C9-1: Pvag_1553Help
Entry
Pvag_1553         CDS       T01326                                 

Gene name
yeaD
Definition
(GenBank) UPF0010 protein yeaD
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00010  Glycolysis / Gluconeogenesis
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
pva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pvag_1553 (yeaD)
Enzymes [BR:pva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pvag_1553 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADO09741
UniProt: E1SFB0
LinkDB All DBs
Position
1634063..1634956
Genome map
AA seq 297 aa AA seqDB search
MQDKLFSLPVVTQISPYLSQRQVGELPTIVVSHPKVRAAITLQGAHLIAWQPSGEKPVLW
LSDKSLFSPGKAIRGGVPICWPWFGPAGEPAHGFARIQTWKLTAHDENEDGVMLTLVLES
NAQTLKLWPHEFTLIARFRLGQHCEIELEAHGDFEATAALHSYFTVSDINGVEVSGLGNS
YIDKVNNGEVASSDGKQRYPGRIDRIFTAAEDCSVINDTAGERQIEVYHHHHSDVVTWNP
GVELSCSMADIANEGYKTMVCVETARISKPLRSAGEKPARLATTFRLKKKVAASDKA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataaactgttttctctgcccgtggttacgcagatctccccttacctttcgcag
cgtcaggttggcgaattaccgacgattgttgtcagtcatccaaaagtacgggcagcgatc
acgctgcagggcgcgcacctgatcgcctggcagccgagtggcgaaaagccggtactgtgg
ctgagcgacaagagtctgttttcaccaggcaaagcgatacgtggcggcgtaccaatctgc
tggccctggtttggtccggcaggcgaaccggcacacggttttgcccggattcagacatgg
aagcttacggcgcatgatgagaatgaagatggcgtaatgctgacgctggtgcttgagagc
aacgctcagacgctgaaactgtggccacacgaatttaccctgatcgcccgtttccgcctg
ggtcagcattgtgagattgaactggaagcgcatggtgactttgaagccacggcagccctg
catagctactttaccgtcagtgacatcaacggcgttgaggtttccggtctgggcaacagc
tatatcgacaaagtaaataacggtgaggttgccagcagtgatggcaaacagcgctatccg
ggacgcatcgaccgtatcttcactgcagcagaagattgctcggtcatcaatgatacagcc
ggtgagcgacagatcgaagtttatcaccaccatcacagtgacgttgtcacttggaatccg
ggtgtggaactctcctgcagcatggcggatattgcgaatgaagggtataagacaatggtc
tgtgtagagacggcccgaatcagtaagccgctgcgcagtgcgggtgaaaaaccggcacgc
ctggccacaacgttccgtcttaagaagaaagtcgcagccagcgacaaagcttag

DBGET integrated database retrieval system