KEGG   Pantoea vagans C9-1: Pvag_2966Help
Entry
Pvag_2966         CDS       T01326                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00564  Glycerophospholipid metabolism
pva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pvag_2966 (glpD)
Enzymes [BR:pva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Pvag_2966 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ADO11116
UniProt: E1SGW6
LinkDB All DBs
Position
3128674..3130179
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHLAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KSLRFGADSALKPEITRGFEYSDCWVDDARMVVLNAQEVVKRGGEVRTRTRVTRAWREGG
LWKVEAEDVDTGKTFTWQAKGLVNAAGPWVKQLFDDSLKLKSPYGIRLIKGSHIVVPRVH
TEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKNVNIDDNETEYLLKVFNGHF
KKQLTADDIVWSYSGVRPLCDDESDSPQAITRDYTLDVRDDNGQAPLLSVFGGKLTTYRK
LAEHALEKLVKYYPNAGPAWTKNCVLPGGNISGTREDYAASLRRRYPFISENMARHFSRT
YGSSTETLLAGAKSLDDLGENFGHEFYEAELRYLVQHEWVRELDDAIWRRTKQGMWLTKE
QQARVAEWLAAKAKPVLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgtgatcggcggcggcatcaacggtgccggcattgcagca
gacgctgcaggacgcggactgtcggtgttaatgctggaggcgcgggatctggcttgcgcg
acctcctctgccagttcaaaactgattcacggcggcctgcgctaccttgaacattacgaa
ttccgtctggtcagtgaagcactggccgagcgcgaagtcctgctgaaaatggccccgcat
ctggcgttcccgatgcgcttccgtctgccgcaccgtccgcacctgcgtccggcatggatg
atccgcaccggcctgtttatgtatgaccatctcggcaagcgtaccagcctgccaggcagt
aaaagtctgcggtttggcgcagattcggccctgaagccggagattacgcgcggattcgaa
tattctgactgctgggtcgatgatgcccgcatggtagtactgaatgcgcaggaagtggtg
aagcgtggcggtgaagtccgtacccgcacccgtgtaacccgtgcctggcgcgaaggtggc
ttgtggaaggttgaagcggaagatgtcgataccggcaaaacctttacctggcaggcgaaa
ggcctggtcaacgctgctggcccatgggttaagcagctgtttgatgacagcctgaagctg
aaatcgccttacggtatccgcctgatcaaaggtagccacatcgtggtgccgcgcgttcat
accgagaagcaggcttatattctgcagaacgaagataaccgtatcgtgtttgtcatcccg
tggatggatgagttctccatcatcggcaccaccgatgtggagtacaaaggcgatcctaaa
aacgtcaatatcgacgacaacgagaccgaatacctgctgaaagtgttcaacgggcacttt
aaaaagcagctgaccgctgacgatatcgtctggtcttactctggtgtgcgtccgctgtgt
gatgatgaatccgattcaccgcaggcgatcacccgtgactacacgctggacgtacgcgac
gataatggtcaggcaccgctgctttccgtattcggcggcaagctgaccacctatcgtaag
ctggcggaacatgcgctggaaaaactggtgaaatactacccgaacgccggtccggcctgg
accaaaaactgcgtgttgccgggtggcaatatctccggcacccgtgaggattatgcagcc
agtctgcgtcgtcgttatccgttcatcagcgaaaatatggcgcgtcatttctcgcgcact
tatggcagcagtacggaaaccctgctggctggcgcgaaaagtctggatgacctgggtgag
aacttcggacacgagttctacgaagccgaactgcgctacctggtgcagcatgagtgggtg
cgtgaactggatgatgctatctggcgtcgtaccaaacagggtatgtggctgaccaaagag
cagcaggctcgcgttgccgagtggctggcagcgaaagcaaaacccgttctgtcactggcc
tcctga

DBGET integrated database retrieval system