KEGG   Pantoea vagans C9-1: Pvag_pPag20164
Entry
Pvag_pPag20164    CDS       T01326                                 

Definition
(GenBank) hypothetical protein
  KO
K22113  fumarate---(S)-2,3-diaminopropanoate ligase [EC:6.3.2.46]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00997  Biosynthesis of various secondary metabolites - part 3
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
Module
pva_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Pvag_pPag20164
Enzymes [BR:pva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.46  fumarate---(S)-2,3-diaminopropanoate ligase
     Pvag_pPag20164
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: ADO08154
UniProt: E1PKW2
LinkDB
Position
pPag2:108037..109209
AA seq 390 aa
MNLELWVQNISATFPWYAQLLRDKQADLSRLESLPLITEELLTQHYYHAENSFHGEHHSY
LTSGTTSGKRKRIFYSDNDQRIYLQQRMEIIRDFCGEGHTRACADLGTGHAAATAGEIFQ
AMGCDVELIDFTRPIEQHIEVLNRFKPDIFFTMPMILDSLIATGKLDFQPKRIILLGDVA
SLDWQNKVADYFHIQPAQVLDLFGSIEIGSIAFYNHALKRYQFDSYVRPEVVPVQSLYPG
AKYGGDGGILLLTSFAREYFPAVRFVTNDLIEGFAQENIGGRTIYTYQRCLGRFAGEFKH
GEKINLSDISDALANNLPYHKYDLADHEGGLVIRIAAKSIPTEVSAAIKHDLLARNPDIA
QMISSGLVGDIRIQCVDAQEITGNVSKRRY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgaatctggaactgtgggtacaaaacatcagcgccacattcccatggtatgcgcaatta
ctcagggataagcaggcagatctcagccgcctggagtcgctcccacttattacagaggaa
ctgctgacgcagcattactaccatgcggaaaatagctttcacggagagcatcacagttat
ctgacatctggtaccacatccggcaagcgtaagcgtatcttttattccgataatgatcag
cgtatttatttgcaacaacgcatggagatcatcagagatttttgcggagaagggcatacc
cgcgcctgtgctgatctgggtacaggtcatgcggccgcaacagccggagaaatttttcag
gcaatggggtgtgatgtcgaattgatcgatttcacaaggccgattgagcaacatatcgag
gtgcttaaccgcttcaagcctgacattttttttacaatgccgatgatacttgattctctt
atagcaaccggaaaactcgattttcagccaaagaggatcatcttgttaggcgacgttgca
agtttggactggcaaaataaagtagcggactacttccatattcaaccagcgcaggtttta
gatctctttggtagcattgaaatcggctctatcgccttctataaccatgcactcaagcgt
tatcagtttgattcatatgtgcgaccagaagttgtgccggtacaaagtctatatcctggt
gcgaaatatggtggtgatggcggtattttactgctcacttcgtttgctcgtgaatacttc
ccggctgtacgttttgtgactaacgatttaattgaaggattcgcacaggaaaatattggt
ggacgaaccatttacacttatcagcgttgcttaggccgttttgccggtgaattcaagcac
ggtgaaaaaattaacctcagcgatataagtgatgctttggcaaataacctgccttatcac
aaatatgatctcgccgatcatgaaggcggcctggtaattcgcatcgcggcaaaatcaatt
ccgaccgaagtcagtgcagctatcaagcatgatctgttggcccgaaaccccgatatagct
caaatgatttcttccggattggtcggtgatattcgtattcagtgtgttgacgcacaggaa
atcaccggcaacgtcagtaaacgccgctactaa

DBGET integrated database retrieval system