KEGG   Providencia vermicola: G3341_10715Help
Entry
G3341_10715       CDS       T06449                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pvc  Providencia vermicola
Brite
KEGG Orthology (KO) [BR:pvc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G3341_10715 (ahpF)
Enzymes [BR:pvc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     G3341_10715 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_binding_3 AlaDh_PNT_C FAD_oxidored Thi4 NAD_binding_8 K_oxygenase NAD_binding_7 Glutaredoxin FMO-like Chalcone_N
Motif
Other DBs
NCBI-ProteinID: QIC16125
LinkDB All DBs
Position
complement(2394556..2396136)
Genome map
AA seq 526 aa AA seqDB search
MLDNNMQAQLKAYLERLTKPVELVANLDSGNKSNEIKELLHQIAALSDKITVRETQDASQ
RIPSFLITNPGVDSGLRFAGSPLGHEFTSLVLALLQIGGHPSKEAQELLDQVKALEGEFH
FETYYSLSCHNCPDVVQALNLMAVLNPNVTHTAIDGALFQNEIEQRNVMGVPAVFLNGKE
FGQGRMTLSEIVNKVDSNADARAAKALTEREPFDVLVIGSGPAGASAAIYTARKGIRTGV
IGERFGGQVMDTVDIENYISVIKTEGAIFAGALKNHVDDYSVDVIDGQSVTKLIPAAEEG
GLHQIETASGGVMKSRSIIIATGARWRNMGVPGEQEYRTKGVTFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGLVEHVTVLEFAPELKADSVLQDKVRSLKNVDIILNAQTLEVKGD
GSKMTGLEYKDRTNDSVHLLEVAGAFVQIGLLPNTNWLGDTVARNRMGEIEVNARGETNI
KGIFAAGDCTTVPYKQIIISAGEGAKAALSAFDYLIRTSTRTAEEV
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataacaatatgcaagcgcaattgaaggcttatttagaaagattaaccaaacct
gttgagttagttgcaaatttagatagcggcaataaatcaaacgaaataaaagagctgtta
catcaaattgctgcactttctgacaaaatcactgttcgtgaaacccaagatgctagccaa
agaataccctcatttttaattacgaatccaggggtcgatagtgggttgcgttttgctggt
tcaccattgggccatgaatttacatcattagtgcttgcgttattacaaattggcggtcac
ccgtctaaagaagcacaggaattattagatcaagtgaaagcccttgaaggggaattccac
tttgagacgtattactcattatcttgccataattgcccagatgttgtgcaagcgttgaac
ttgatggcagttttgaacccaaatgtcactcataccgccattgacggtgctttgttccaa
aatgaaatagaacaacgcaatgtgatgggcgtgccggctgttttcctgaatgggaaagaa
tttggtcaaggccgtatgacattaagtgagatagtgaataaagttgacagtaatgcagat
gcacgtgcagctaaagcattaactgagcgcgaaccatttgatgtattggttattggtagt
ggtcctgctggtgcatcggctgcgatttataccgcacgtaaaggtattcgcactggtgtg
atcggtgagcgcttcggtggtcaagtgatggatacggttgatatcgaaaactatatttct
gtgattaaaacagaaggtgcgatattcgcgggagcactgaaaaaccacgttgatgactat
agtgtcgatgttattgatggtcagtctgtgaccaaattaattccagcagcggaagaaggt
ggcttacaccaaattgaaacagcatcgggtggcgtgatgaagtcacgcagcatcattatt
gcgacaggcgctcgctggcgcaatatgggggtaccgggtgaacaagaatatcgcacgaaa
ggcgtgactttctgcccacattgcgatggcccactatttaaaggcaaacgtgttgctgtg
attggtggtggtaactcaggtatagaagcagctattgatttggccggtcttgttgaacat
gtgaccgtattagaatttgcgcctgaactgaaagcagactcagtattacaagataaagta
cgcagcctgaaaaatgtcgatattatccttaatgcccagacattagaagttaagggtgat
ggtagtaaaatgacaggtcttgagtataaagatcggacgaatgatagcgttcatttatta
gaagttgcaggtgcatttgttcaaattggtttattacccaataccaattggttaggggat
accgttgcacgcaaccgcatgggtgaaattgaagtgaatgcgcgtggcgaaaccaatatt
aaaggtatttttgcagcaggtgactgtacaactgtgccatacaagcagattattatttca
gccggtgagggagcgaaagccgcacttagcgcctttgattacctcatccgcacaagtacc
agaaccgctgaagaggtgtaa

DBGET integrated database retrieval system