KEGG   Pseudomonas viridiflava: CFBP1590__3009Help
Entry
CFBP1590__3009    CDS       T06554                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pvd  Pseudomonas viridiflava
Brite
KEGG Orthology (KO) [BR:pvd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CFBP1590__3009 (ahpF)
Enzymes [BR:pvd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CFBP1590__3009 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C Thi4 Glutaredoxin K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: SMS10595
LinkDB All DBs
Position
I:complement(3316483..3318045)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLNSPGHNISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRNLQGEFKF
ETYFSQSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADRLIPGAAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKNRVTGEEITVPLEGIFVQIGLLPNSEWLKGSIELSPRGEIVVDSRGETSIPG
VFAAGDVTVAPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcttacctggagcgggtcactcgcccc
atagagatcgtcgcgtcccttgatgacggcgcgaagtctcaggaaatgcttgcactgctc
aacgatgtgatcagtgtttccaaagacgtcaccttgaatgacagcggcaccgatgcgcgc
acgccatcgttctcgctgaacagccctggccataatatcagcctgcgtttcgctggtatt
ccaatgggccacgaattcacctcgctggtcctggcgctgctgcaagtcggcggctaccca
cccaaggtcagtgcggaaaccatcgagcaggttcgcaatcttcaaggcgaattcaagttc
gaaacctatttctcgcagtcctgccagaactgcccggacgttgtccaggcgctgaacctg
atggcagtgctgaacccgaacatcaagcacgtcgcaatcgacggcgcgctgttccaggac
gaagttaccgatcgcaagatcatgtcggtgccaagcatctacctgaacggcgagctgttt
ggtcagggccgcatgggcttggaagaaattctggccaaaatcgacaccggtgcaggggct
cgtcaggccgagaaactcaatgccaaagaggcgttcgacgttctcgtggttggcggtggc
cctgccggttcggcagctgctgtttatgctgcacgtaaaggcattcgtaccggtgttgcc
gcagagcgtttcggtggccaggtgctcgacaccatggccatcgagaacttcatctcggtc
cagcacaccgaaggcccgaagctggctgtagcgctcgaggagcacgtcaagcagtacgaa
gtcgacatcatgaatctgcagcgcgccgacaggctgattccaggcgcagccggtgagttg
cacgaagtgaagttcgccagcggcgcgagccttaaggccaagaccgtgattctcgccacc
ggcgcacgctggagggagatgaatgttccgggcgagcagcaataccgcaacaagggcgtg
gcgtactgcccgcactgtgacggtccgctgttcaagggcaagcgcgttgcagtgatcggc
ggcggtaactccggcgttgaagcggccatcgacctggcgggcatcgtttctcacgtgacc
ctgctggagttcgacgtgcagttgcgtgctgacgcggttctgcagcgcaagctgcacagt
ctgccgaacgtgaccgtcatcaccagtgcgcaaaccactgaagtgaccggtgacgagcaa
aaggtcaacggtctgcgttacaagaaccgcgtaaccggtgaagagatcaccgtgccgctg
gaaggtatcttcgtgcagatcggcctgctgcctaacagcgaatggctcaagggctccatc
gagctgtcgccgcgtggcgagatcgtggtcgattcgcgcggtgagacttcgatacctggc
gttttcgctgccggtgacgtgactgtggcaccgtacaagcagatcatcattgctcttggc
gagggtgccaaggcttcgctgagtgcctttgatcacctgatccgtacgtccgcgccagcc
tga

DBGET integrated database retrieval system