KEGG   Pandoraea vervacti: UC34_05525Help
Entry
UC34_05525        CDS       T03688                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pve  Pandoraea vervacti
Brite
KEGG Orthology (KO) [BR:pve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UC34_05525
Enzymes [BR:pve01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UC34_05525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored Glutaredoxin Thi4 NAD_binding_8 K_oxygenase FAD_binding_3 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJP56600
UniProt: A0A0C5JWN1
LinkDB All DBs
Position
1210537..1212126
Genome map
AA seq 529 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKALVEAIAPLSDKIAVVFRDDASE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPLKLDDDTIAQIRELDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGSLFQGEVEARQVMAVPTVFLNGES
FTQGRTSVKELLAKLDTGATARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGIVTGV
VAERFGGQVLDTMAIENFISVTHTEGPKFATALEQHVKSYDVDVIDTQRAEALIPGKIHE
VHLASGAVLKARAVVLATGARWREIGAPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGTQLRADEVLQRKLRSLPNVRVLMNAQTTEIVGDGQKV
NGLVYRDRASGETSTIALEGVFVQIGLVPNTEWLKDTVSLSRHGEIEVDAKGATSVPGVF
AAGDVTAVPFKQIVIALGEGAKASLGAFEHLMLSSVEDEIAAAPVAVAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtatcttcagaaagtcacgcgcccc
atcgaaatcgccgtgtggctcgacgacagccccaagtccgccgagatgaaggcattggtc
gaagcgatcgcgccgctgtcggacaagatcgccgtcgtctttcgcgacgatgccagcgag
cgtcgcccgtccttcgcgatcggcacgcccggtgaggcgccgcgcattcgcttcgccggt
ttgcccatgggccatgaattcacgtcgctggtgctggcgctgttgcaggtcggcggtcac
ccgctcaagctcgacgacgacaccattgcgcagattcgcgagctcgacggcgactttcgc
ttcgagacgtacatttcgctgtcctgccagaattgcccggaagtcgtgcaggcgctcaac
gtcatggcgctcatcaacccgcgcatccagcaagtgactatcgacggttcgctgttccag
ggcgaggtcgaggcgcgtcaggtgatggcggtgcccacggtattcctcaacggcgagtcg
ttcacgcaaggccgcacgagcgtgaaggaattgctggcaaagctcgacacgggggcgacg
gcgcgcgctgcgaaggcgctcgaaaacaagcctgtctacgacatgctgatcgtgggcggc
gggcctgccggtgcggcggccgccatttacgccgcgcgaaagggcattgtgaccggggtc
gttgccgagcgtttcggcggtcaggtgctcgacacgatggccatcgagaactttatttcg
gtcacgcataccgaagggccgaaattcgcgacggcgctggagcagcacgtcaagagctac
gacgtcgacgtgatcgacacgcagcgcgccgaagcgctgattccgggcaaaatccacgag
gtgcatctggccagcggtgcggtgctcaaggcgcgtgccgtggtgctggcgacgggggcc
cgctggcgcgaaatcggcgcgccgggcgagcgcgaatatcgcaatcgcggcgtggcctac
tgcccgcattgcgatggcccgctgttcaagggaaaacgtgtggcggtcgtcggtggcggc
aattccggcgtggaagcggccatcgatctggcgggcatcgtcaaggaagtcacgctgatc
gaatacggcacacaactgcgtgcggacgaagtgctccagcgcaagcttcgcagcctgccg
aatgtgcgcgtgctgatgaacgcgcaaacgaccgagatcgtcggcgacgggcagaaggtg
aacggcctcgtgtaccgtgaccgcgcgtcgggcgagacatcgacgattgcgctcgaaggc
gtgttcgtgcagatcggtctggtgccgaacaccgagtggctcaaggacacggtgtcgctc
tcgcgccatggggagatcgaagtggatgcgaagggcgcgacgtcggtgccgggcgtgttc
gccgcgggcgacgtgacggccgtgccgttcaagcagatcgtgattgcgctgggcgaaggc
gcgaaggcgtcgctgggcgcgttcgagcatttgatgctgagttcggtggaggacgaaatc
gccgccgcgccggtcgccgtcgccgcctga

DBGET integrated database retrieval system