KEGG   Pandoraea vervacti: UC34_10955Help
Entry
UC34_10955        CDS       T03688                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pve  Pandoraea vervacti
Pathway
pve00473  D-Alanine metabolism
pve01100  Metabolic pathways
pve01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UC34_10955
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    UC34_10955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
    UC34_10955
Enzymes [BR:pve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     UC34_10955
Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
 Precursor biosynthesis
  Racemase
   UC34_10955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AJP59633
UniProt: A0A0C5JWJ7
LinkDB All DBs
Position
2412952..2414022
Genome map
AA seq 356 aa AA seqDB search
MPRPIKVSIHTAALAHNLDVARRHAPNAKVWAVVKANAYGHGIENAYPGLRDADGFGLLD
LEEAVRLRELGWAGPILLLEGFFKPEDLAIVDKYGLTTTVHSDEQLRMLETARLTKPLNV
QLKMNSGMNRLGFAPDRFRAAWERARAIPGVSQIVLMTHFSDADGERGIAYQMEAFERGA
RDVPGERSLSNSAATLFHPAAHGAWVRPGIMLYGSSPKGLEVTAAELDLQPTMTLESELI
GIQEVPGGGSVGYGSVFTADAPMRVGTVACGYADGYPRVAPTGTPILVDGVLTRTVGRVS
MDMLSVDLTPVPQARVGTPVTLWGRGLCIDDVAASAGTLGYELMCAVARRVPVHAF
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtccaatcaaagtttcgattcataccgcagcactcgcccataatctcgacgtc
gcacgccgccatgcccccaacgccaaggtctgggcggtggtcaaggccaatgcctatggg
cacggcatcgagaacgcgtatcccggattgcgcgacgccgacggattcggcctgctcgac
ctcgaggaagcggtgcgtttgcgcgaactcggctgggccggccccattctgttgctcgaa
ggattcttcaagccggaagatctcgcgatcgtcgacaagtacggcctgacgaccaccgtt
cacagcgatgaacagctacgtatgctggagaccgcgcgtctgaccaagccgctcaacgtc
cagctcaagatgaactcgggcatgaaccgcctgggttttgcgcccgatcgttttcgcgct
gcctgggaacgtgcgcgagccattccgggcgtcagccagatcgtgctgatgacgcatttc
tcggatgccgacggcgagcgcggcattgcgtatcagatggaagcgttcgaacgcggcgct
cgcgacgtgcccggcgagcgcagcctgtcgaactcggcggccacgctgtttcacccggcg
gcgcatggggcgtgggtgcgtccgggcatcatgctttacggttcgtcgccgaaaggcctc
gaggtcacggccgccgaactcgatctccaaccgacgatgacactcgaaagtgagctgatc
ggcattcaggaagtgcccggcggcggctcggtgggctatggcagcgtattcacggcagac
gcgccgatgcgcgtgggcaccgtcgcgtgcggctatgcggacggttatccgcgcgtggcc
cctacgggcacgccgattcttgtcgatggcgtgctgacgcgtaccgtcggccgcgtatcg
atggacatgctgtccgtggatcttacgcccgtgccgcaggcgcgcgtgggcacgcctgtg
acgctgtggggccggggactttgcatcgacgacgtcgcggcatcggcgggcacgctcggg
tatgagctgatgtgtgccgtggcacgtcgcgtgccggttcacgccttctga

DBGET integrated database retrieval system