KEGG   Pandoraea vervacti: UC34_11385Help
Entry
UC34_11385        CDS       T03688                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
pve  Pandoraea vervacti
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Semialdhyde_dh OmdA
Motif
Other DBs
NCBI-ProteinID: AJP57464
UniProt: A0A0C5JZT0
LinkDB All DBs
Position
2512254..2513687
Genome map
AA seq 477 aa AA seqDB search
MKTYDKFFIDGQWVTPLGRGTLDVFHSADAKLMGRIPEGAVEDAEAAVAAARTARDTWAA
TSPAERAGYLRKIAAGLKARTDELAEVMTGETGMPIKLVRAIQVGGPVYHWNKYAELVES
FAFEARVGNSLVVREPVGVVGAITPWNYPLNQITLKVAPALAAGCTVVLKPSEVAPFNAF
ILAEVIAQAGLPAGVFNLVTGLGPVVGEVLARHPDVDMVSFTGSTRAGKRVSEVASQTVK
RVALELGGKSASVVLDDADLAAAVKGTLNACYLNSGQTCSAHTRMLVPASRYDEVKALVR
DAVARFTLGDPREETTRLGPLASAAQQERVQTYIRKGLAEGAELIAGGDTVPEGFEAGFF
VQPTVLGRVTPDATVAQEEIFGPVLSIITYQDEADAVRIANDSIYGLGGGVWSGDEARAV
RVARRIRTGQVDINGGEFNVQAPFGGFKQSGHGRENGVYGFEEFLEYKSLQFKSAKS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtacgacaaatttttcatcgacggccagtgggtaacgccgctcgggcgcggc
acgctggacgtttttcattcggccgatgcgaagctgatggggcgcattcccgagggcgcc
gtcgaggacgccgaagccgccgtcgccgccgcgcgcacggcgcgtgacacttgggcggcg
acgtcgcccgccgaacgggctggctatctgcgaaagattgctgcgggattgaaggcccgt
accgacgaattggcggaggtgatgacgggtgagacgggcatgccgatcaagctcgtgcgc
gcgattcaggtcggtggtccggtctatcactggaacaagtacgccgagttggtcgaatcg
ttcgcgttcgaggcgcgcgtgggcaactctctggtggtgcgtgagccggttggggtggtc
ggcgcgattacgccatggaactatccgctcaaccagatcacgctgaaggttgccccggcg
ctggcggccggttgcacggtggtgctcaagccgtccgaagtcgcgccgttcaatgccttc
attctcgccgaggtcattgcgcaagcgggattgcccgccggcgtcttcaatctggtgaca
gggttggggccggtggttggagaggtgctggcgagacatcccgatgtcgacatggtgtcg
ttcaccgggtcgacgcgggccggcaagcgtgtctccgaagtggcgtcgcaaacggtcaag
cgtgtggcgctggagcttggcggcaagtcggcgtcggtcgtgctcgacgacgccgacctt
gcggcagcggtcaagggcaccctcaacgcctgctatctgaactcgggacagacttgctcg
gcgcacacgcgcatgctggtacccgcgtcgcgctatgacgaagtcaaggcgctggtcagg
gacgccgtggcacgttttacgctgggcgatccgcgcgaggaaacgacgcgtcttgggccg
ctggcctctgctgcccaacaggagcgcgtgcaaacctacatccgcaaagggctggccgaa
ggggccgagctgatcgccggcggcgatacggtgcctgaagggttcgaggcgggcttcttc
gtgcagccgacggttctggggcgtgtgacaccggatgcgacggttgcgcaggaagagatt
ttcggtccggtgctatcgatcatcacctatcaggacgaagccgacgcggtgcgcatcgcg
aacgattccatctatggtttgggcggtggcgtatggtcgggcgatgaggcgagggcggtg
cgtgtggcgcgtcggatccgtaccggacaggtggatatcaatggcggggaatttaacgtc
caggccccgttcggtggcttcaagcagtcggggcacggacgtgaaaatggcgtctacggc
ttcgaggaattcctcgagtacaagtcgcttcagttcaagtctgcgaagtcgtag

DBGET integrated database retrieval system