KEGG   Pandoraea vervacti: UC34_14530Help
Entry
UC34_14530        CDS       T03688                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pve  Pandoraea vervacti
Pathway
pve00020  Citrate cycle (TCA cycle)
pve00310  Lysine degradation
pve00380  Tryptophan metabolism
pve01100  Metabolic pathways
pve01110  Biosynthesis of secondary metabolites
pve01120  Microbial metabolism in diverse environments
pve01130  Biosynthesis of antibiotics
pve01200  Carbon metabolism
Module
pve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UC34_14530
  09105 Amino acid metabolism
   00310 Lysine degradation
    UC34_14530
   00380 Tryptophan metabolism
    UC34_14530
Enzymes [BR:pve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UC34_14530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AJP57865
UniProt: A0A0C5K014
LinkDB All DBs
Position
complement(3316142..3317404)
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQFSESVSEGTLLDWKKKVGEAFAQDETIIEVETDKVVLEVPAPAAGVLVEV
SAAAGDTVTSEQIIAKIDTEAKAGAAAPVAAKPAETAAPAAAPAAAPAAGGASGNIASPA
AAKVLAEKNLSAGDVAGSGRDGRVTKGDALAAGAKPAAAAASSIPAPAQRAALPSVAAPT
GRDQSLEGRPEQRVPMSRLRARIAERLLQSQQTNAILTTFNEVNMKPVMDLRNKYKDKFE
KEHGVKLGFMSFFVKAAVHALKKYPAVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSLADIEKKIAEYGKKAADGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGEIVIRPMNYLAMSYDHRIIDGREAVLSLVAMKEALEDPARLLLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggccattgttgaagtcaaagtcccccagttttccgagtcggtttccgaaggcacgctg
ctcgactggaagaagaaagtcggcgaagcgtttgcgcaggacgaaaccatcattgaagtc
gagaccgacaaggtcgtgctcgaagtgccggccccggccgctggcgtgctcgtcgaagtg
tcggccgctgccggcgacaccgtgacgtccgaacaaatcattgccaagatcgacaccgaa
gccaaggcaggcgccgctgcgccggtcgccgccaagccggccgaaaccgctgcgccggct
gccgccccggccgccgcccccgccgccggtggtgcttcgggcaacatcgccagcccggcc
gctgccaaggtgctggccgagaagaacctgtcggccggcgacgtcgccggttcgggccgt
gacggccgcgtgaccaagggcgacgccctggctgccggcgccaagccggcggctgcggcg
gcttcgtcgatcccggccccggcacaacgtgccgcactgccgtcggtcgctgccccgacg
ggccgcgaccagtcgctcgaaggccgtccggaacagcgcgtgccgatgtcgcgtctgcgc
gcccgtattgccgagcgtctgctccagtcgcaacagaccaacgccattctgaccacgttc
aacgaggtcaacatgaagccggtgatggatctgcgcaacaagtacaaggacaagttcgag
aaggaacacggcgtgaagctgggcttcatgtcgttcttcgtcaaggccgccgtgcacgcg
ctcaagaagtacccggccgtgaacgcctcgatcgacggtaacgatatcgtctaccacggc
tacttcgacatcggtatcgctgtcggctcgccgcgtggtctggtggtgccgatcctgcgc
aacgccgatcagatgagcctcgccgacatcgaaaagaagatcgccgagtacggcaagaag
gctgccgacggcaagctgtcgatcgaagaaatgaccggcggtacgttctcgatctcgaac
ggcggcgtgttcggctcgatgctgtcgaccccgatcatcaaccccccgcagtcggccatt
ctcggcgtgcacgccacgaaggaccgtgccgtcgtggaaaacggcgagatcgtcatccgc
ccgatgaactacctcgccatgagctacgaccaccgtatcatcgacggtcgcgaagccgtg
ctgagcctcgtcgccatgaaggaagcgctggaagatccggctcgcctgctgctcgacctg
taa

DBGET integrated database retrieval system