KEGG   Pandoraea vervacti: UC34_18025Help
Entry
UC34_18025        CDS       T03688                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pve  Pandoraea vervacti
Pathway
pve00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UC34_18025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pve01002]
    UC34_18025
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
    UC34_18025
Enzymes [BR:pve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     UC34_18025
   3.4.21  Serine endopeptidases
    3.4.21.-  
     UC34_18025
Peptidases [BR:pve01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   UC34_18025
Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   UC34_18025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AJP59885
UniProt: A0A0C5K4Y0
LinkDB All DBs
Position
4148395..4149951
Genome map
AA seq 518 aa AA seqDB search
MGGLADATRIARAGVTTVAILSAALAVAMAVSAPAQAKPAKIAKKAPRVPVTAAHATPLP
PPLARALATSQVPPSHVSVIVAKVDNPLQTRGAIPAPMLALNPNVPRNPASTMKLVTTIA
ALDMLGPDYRWRTQAFTDGQSDGRTLNGNLYFKGTGDPKLVPEEMEKFIAELHNAGVTNL
NGDIVLDRSAYSADIGAQGPIDGDADRPYNVAPDPLLYSFKAMSFTFTSNPNGTVDVGVL
PPLANLQVANEMSSAAAGNCGDWLARIHPSVSTTADGAYLAHFSGPYPASCEDKGWNIAA
PDRDRFFLGGFRALWQASGGQFNGNVRTGVVPPGARLLVTHRGQTLAEVVHDMNKFSNNV
MARQLFLTLGLAADGKTPASIARSRDVLGRWLDKNDLAMPSLVVENGSGLSRVERISAME
LARLLQHGINSPTGQVLVESMPTVGVDGTMRNRLTNRDVAGNAHVKTGTLDDVSAVAGYV
ATRSGSTYVVVSLVNDPRASNARGFNDALISWVYENAP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggcttgccgatgccactcgcatcgcgcgtgcgggcgtgacgacagtggcgata
ctgagcgcagcgctggccgtggctatggccgtaagtgcgccggcgcaagccaagccggcc
aagattgcgaagaaggcccccagggtgccggtcactgcggcgcacgccaccccgctgccg
ccaccgctggcgcgcgcgctcgccacgagccaggtcccgccctcgcatgtcagcgtgatc
gttgcgaaggtcgacaatccgttgcagacgcgcggcgcgattcccgccccgatgctcgcg
ctcaaccccaacgtgcctcgcaatccggcctcgacgatgaaactcgtcacgacgattgcc
gcactggacatgctgggtcccgattaccgctggcgcacgcaggcgttcaccgacggtcag
tcggacggccgcacgctcaacggcaatctgtacttcaagggcacaggcgacccgaagctg
gtgccggaagagatggagaagttcatcgcggaactgcacaacgcgggcgtgacgaacctc
aacggcgacatcgtgctcgaccgctcggcttacagcgcggatatcggcgcgcagggtccg
atcgatggcgatgccgatcgtccctacaacgtggcgccggacccgctgctgtactcgttc
aaggcgatgtcgtttacgttcacgagcaatcccaacggcacggtcgacgtcggtgtgctg
ccgccgctggcgaacttgcaggtcgccaacgagatgtcgtcggcagctgccggcaattgc
ggcgactggctggcccgcatccatccttccgtgagcacgaccgccgacggcgcttatctc
gcgcacttctcgggaccgtacccggcgtcttgcgaagacaagggatggaatattgccgcc
cccgatcgcgaccgcttcttcctcggtggctttcgtgccttgtggcaggcctccggcgga
cagttcaacggcaatgtgcgtaccggggtcgtgccgcccggcgcgcgactgctcgtcacg
catcgcggtcagacgctggccgaagtcgtgcacgacatgaacaagttcagcaacaacgtc
atggcgcggcaactcttcctcacgctgggactggccgccgacggcaagacgccggcgagc
atcgcgcgctcgcgcgacgtcctcggtcgctggctcgacaagaacgatctcgccatgccc
agcctcgtcgtggagaacggctcgggactctcgcgcgtggaacgcatcagcgccatggag
ctggcgcggctgctgcaacacggcatcaacagtccgaccgggcaggtgctcgtcgagtcg
atgccgaccgtcggcgtggacggcaccatgcgcaaccgtctgaccaatcgcgacgtggcg
ggcaacgcccatgtgaagacgggcacgctcgacgatgtgagtgcggtcgcgggctacgtg
gccacccgctcgggcagcacgtatgtcgtggtgtcgctggtcaacgatccccgcgcgagc
aacgcacgcggcttcaacgacgcgctcatctcgtgggtgtacgaaaacgccccgtga

DBGET integrated database retrieval system