KEGG   Pandoraea vervacti: UC34_19110Help
Entry
UC34_19110        CDS       T03688                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
pve  Pandoraea vervacti
Pathway
pve00620  Pyruvate metabolism
pve01100  Metabolic pathways
pve01120  Microbial metabolism in diverse environments
pve01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UC34_19110
Enzymes [BR:pve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     UC34_19110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Malate_DH
Motif
Other DBs
NCBI-ProteinID: AJP58490
UniProt: A0A0C5K1E6
LinkDB All DBs
Position
complement(4412113..4414401)
Genome map
AA seq 762 aa AA seqDB search
MSNSNDHQAALEYHQFPTPGKISVTASKPLVTQRDLALAYTPGVAIPCQEIAADPSASFK
YTGRGNLVGVITNGSAVLGLGNIGALASKPVMEGKAVLFKKFAGIDVFDIEITESDPDKL
VDIIASLEATFGGINLEDIKAPECFTVERKLRERMKIPVFHDDQHGTAITVSAAFINGLK
VVGKDIREVKVVTSGAGAAALACLDLMIDLGLPIENIWATDIDGVVYEGRAASMDPDKAR
FAQKTDKRTLAEVIDGADVFIGLSAGGVLKPEMLKTMAARPLILALANPTPEIFPDDARA
VREDAVLATGRSDFPNQVNNVLCFPYIFRGALDVGATTITRNMEIAAVHAIAGLAQEEVN
DSVANAYGAYDLSFGPEYLIPKPFDSRLIVRIAPAVARAAMEDGVATRPIADFDAYADQL
QQFVYHSGAFMKPIFSAAKQFVRDGGKSRIVFAEGEEERVLRAVQVIVDEKLARPILVGR
PEVLLARIEKFGLRLRLGEDVEVTNPYYDERFHQYWTSYWELRCRDGITKEMARVEMRRR
LTLIGAMMVRLGDADGMICGTVGAYHDHLRFVDEVIGKQPGANTYAAMNILLLDKRTVAL
VDTHVNDDPSAEQITEFTLAAARQMSRLNLNPKVALLSRSNFGSGSAASGTKMRRVLDMV
TAQAPDLEIDGEMHGDCALDEALRSRILPHSKLKGAANLLVCPNVDAGNIAYNLLKTGAG
SNVAVGPFLLGVGAPVNVLTSSSTVRRIINMTALTVIQANRD
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagcaacgatcaccaggccgccctggaatatcaccagttcccgactccgggc
aagatctccgtgacggccagcaagccgctggtgacgcaacgcgatctcgcgctggcctac
accccgggtgtcgccatcccgtgccaggaaatcgccgccgacccgtcggcgtcgttcaag
tacaccggtcgtggcaatctcgtcggcgtgatcaccaacggctcggccgtgctggggctg
ggcaacatcggcgcgctcgcctccaagccggtcatggaaggcaaggccgtcctgttcaag
aaattcgccgggatcgacgtcttcgacatcgaaattaccgagagcgacccggacaagctg
gtcgacatcatcgccagcctggaagcgaccttcggcggcatcaacctcgaagacatcaag
gcgccggagtgcttcaccgtcgagcgcaagttgcgcgagcgcatgaagatccccgtcttc
catgacgatcagcatggcaccgccatcacggtcagcgccgcgttcatcaacggtctgaag
gtggtcggcaaggacattcgcgaagtgaaggtcgtgacctcgggcgccggtgcggcggcc
ctcgcgtgcctcgatctgatgatcgacctcggcctgcccatcgagaacatctgggcgacg
gacatcgacggtgtcgtgtacgaaggccgtgcggccagcatggatccggacaaggcccgt
ttcgcgcagaagaccgacaagcgcacgctcgccgaagtgatcgacggtgcggacgtgttc
attggcctgtcggcgggcggtgtactcaagcccgagatgctcaagacgatggccgcgcgc
ccgctgattctggcgcttgccaacccgacgccggaaatctttccggacgacgcgcgcgcc
gtgcgtgaagacgccgtgctcgccactggccgctcggacttcccgaatcaggtcaacaac
gtcctgtgcttcccttacatcttccgcggtgcgctcgacgtgggcgccaccacgatcacg
cgcaacatggaaatcgccgccgtgcacgcgattgccggtctggcgcaggaggaagtgaac
gattccgtggcgaacgcctatggcgcgtacgacctgtcgttcgggccggaatacctgatt
ccgaagccgttcgactcgcgcctgatcgtgcgcattgcgccggccgtggcgcgtgccgcc
atggaagacggtgtggccacgcgcccgatcgccgacttcgacgcctatgccgaccagttg
cagcagttcgtgtatcactcgggcgcattcatgaagccgatcttctccgcggcgaagcag
ttcgttcgcgatggcggcaagtcgcgcatcgtgtttgccgaaggcgaggaagagcgtgtg
ttgcgcgcggtgcaggtcatcgtcgacgagaagctggcgcgtccgattctcgtgggccgc
ccggaagtgctgctcgcccgcatcgaaaagttcggcctgcgcctgcgtctgggcgaagac
gtggaagtcaccaacccgtactacgacgaacgtttccatcagtactggaccagctactgg
gaactgcgctgccgcgacggcatcacgaaggaaatggcgcgagtggaaatgcgtcgccgt
ctcacgctgatcggcgcgatgatggtccgtctgggcgacgccgacggcatgatctgcggc
accgtgggcgcgtaccacgatcacctgcgattcgtcgatgaagtcatcggcaagcagccg
ggcgcgaacacttacgctgcgatgaacatcctgctgctcgacaagcgcaccgtggcgctc
gtcgacacgcacgtcaacgacgatccgagcgccgagcagatcaccgagttcacactggcg
gctgccaggcagatgtcgcgtctgaacctcaacccgaaggttgcgttgctctcgcgctcg
aacttcggctcgggcagtgcggcgtcgggcacgaagatgcgtcgtgtgctggacatggtg
acggcgcaggcgccggacctcgagatcgacggtgaaatgcacggcgactgcgcgctcgac
gaagcgctgcgcagccgcatcctgccgcattcgaaactcaagggcgcggccaacctgctg
gtgtgcccgaacgtcgacgccggcaacatcgcctacaacctgctcaagacgggcgccggc
agtaacgtggcggtcggtccgttcctgctgggcgtgggcgcaccggtcaacgtgctgaca
tcgagctcgacggtgcgacgcatcatcaacatgacggcgctcaccgtcatccaggccaat
cgcgactga

DBGET integrated database retrieval system