KEGG   Pandoraea vervacti: UC34_21720Help
Entry
UC34_21720        CDS       T03688                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pve  Pandoraea vervacti
Pathway
pve00473  D-Alanine metabolism
pve00550  Peptidoglycan biosynthesis
pve01100  Metabolic pathways
pve01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    UC34_21720
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UC34_21720
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    UC34_21720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
    UC34_21720
Enzymes [BR:pve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     UC34_21720
Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
 Precursor biosynthesis
  Amino acid ligase
   UC34_21720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATPgrasp_ST ATP-grasp_4 CPSase_L_D2 TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AJP58855
UniProt: A0A0C5K2C8
LinkDB All DBs
Position
complement(4977830..4978813)
Genome map
AA seq 327 aa AA seqDB search
MSAFDPKRFGKVGVLMGGRSAERQISLISGNGVLEALRNRGVDAHAFDTGMNDLTVLAAQ
KFDRVFIALHGRYGEDGTLQGALEHLGIPYTGSGVLASALAMDKEMTKRIWINEGLPTPR
FTMLHADTDFDAVARDLGLPLIVKPSREGSTIGLTKVTEASQLKAAFEKAVALDPDVLAE
EFIDGDELTVPVLGVGTKGANAARSLPVIRIVAPDANYDYQNKYFKDDTRYECPPPLSVS
LQEEVQRLVLRAYLVLGCRGWARADVMLRKRDNKPYLLEINTSPGMTGHSLVPISARAAG
LSYEDLVVEILATATLDLHPNAQWKPE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgctttcgatccgaaacgtttcggcaaggttggcgtcctgatgggcgggcgctcg
gccgagcgtcagatctcgctgatttcgggcaatggtgtgctcgaagcgttgcgcaatcgc
ggcgtggatgcgcatgccttcgataccggtatgaacgacctgaccgtgctcgccgcgcag
aagttcgaccgcgtgttcatcgcgctgcatgggcgttatggcgaagacggcacgctccag
ggtgcgctggagcatctgggcattccctacaccggcagcggtgtgttggcttccgcgctg
gcgatggacaaggaaatgaccaagcgcatctggatcaacgaagggttgcccacgccgcgc
ttcacgatgctgcatgccgataccgatttcgacgccgtcgcgcgcgatctgggtctgccg
ctcatcgtcaagccgtcgcgtgaaggctcgacgatcggtctgacgaaagtcaccgaagcg
tcgcaattgaaggcggcgttcgagaaagccgtggcgctcgatccggacgtgctggccgaa
gagttcatcgatggcgacgagctgaccgtgccggtactgggtgtgggtaccaagggggcg
aacgcggcgcgctcgctgccggtgatccgtatcgttgccccggatgcgaactacgactac
cagaacaagtacttcaaggacgacacgcgctacgaatgcccgccgccgttgtcggtgtcc
ttgcaggaggaagtgcagcgcctggtgctgcgcgcctacctcgtgctcggttgccgtggc
tgggcgcgcgccgacgtgatgctgcgcaagcgcgacaacaagccgtatctgttggagatc
aatacgtcgccgggtatgaccggccactcgctggtgccgatttcggcgcgggcggcgggc
ctgtcgtatgaagacctggtggttgaaattctggcgactgcgacgctcgatctgcatccg
aacgcgcagtggaagcccgagtga

DBGET integrated database retrieval system