KEGG   Pandoraea vervacti: UC34_22775Help
Entry
UC34_22775        CDS       T03688                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
pve  Pandoraea vervacti
Pathway
pve00550  Peptidoglycan biosynthesis
pve01100  Metabolic pathways
pve01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    UC34_22775
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    UC34_22775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pve01003]
    UC34_22775
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
    UC34_22775
Enzymes [BR:pve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     UC34_22775
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     UC34_22775
Glycosyltransferases [BR:pve01003]
 Polysaccharide
  Bacterial polysaccharide
   UC34_22775
Peptidoglycan biosynthesis and degradation proteins [BR:pve01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   UC34_22775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB PIG-P
Motif
Other DBs
NCBI-ProteinID: AJP59002
UniProt: A0A0C5KGU8
LinkDB All DBs
Position
5224769..5227219
Genome map
AA seq 816 aa AA seqDB search
MASTPQTETPRDKRPPKPRRSIWLRLALWFVGLIAAMVVCGALLAGYVLVVMTPQLPSLD
TIVDYRPKIPLRIYTADEIQIGEFGEERRNLVRFADIPDVMKKAVLAIEDDRFYQHGGVD
FIGIFRAGVANFTRGGSSQGASTITMQVARNFFLSSEKTYTRKIYEALLAYKIESRLSKD
QILELYMNQIYLGERAYGFASAARVYFGKDLKDITLAEAAMLAGLPKAPSAYNPIVNYKR
ARVRQEYILKRMYDLGYVSKAEYDQAIAQEMVVRGLGSEFSVHAGYVAEMVRQLLYAQFK
DEIYTRGFNVYTTINSADQEAAYEALRAGVMAYELRHGYRGPEANIDLPDGKDEREQLID
DTLVEHPDSGDMVAAVVLSATPQQVKAVLLNGDDVTVTGDGLRFAAAGLSAKAQPKQKIR
AGSVIRVTKDAKENWRIVQMPDIEAAFVSLDPQNGAIRSLVGGFDFNRNKFNHVTQAWRQ
PGSSFKPFIYSAALEKGFAPATIINDAPLYFTAAQTGGQPWEPKNYGGGFDGPEPMRVAL
MRSRNLVSIRILQSITPGYAQKFIGRFGFEADKHPAYLPMALGAGMVTPLQMASGYAVFA
NGGFRVNPFIVARITDSKGSVIMEEKPTTAGDESIRAIPARNAFLMNSMLHDVATRGTAA
KTNALKRSDLAGKTGTTNDSHDAWFAGYQSQLVGVAWIGFDQPRNLGDRETGGGLALPIW
IDYMSKALRGVPEATRPMPPGIIQANGDYFYDDYPPGRAVSTVGLSAEPAPDGSASPGPS
GALPGQMPAQSGPAPAPAPVDRQERQRILDMFNSKP
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcacaccccaaaccgagacaccccgcgacaagcgtccgcccaaaccgcgccgc
tccatctggctgcgcctcgccctttggttcgtcggccttatcgctgcgatggtcgtatgt
ggcgcgttgctcgcggggtacgttctggtcgtcatgacgccgcagttgccgtcactggac
accatcgtcgattaccggccgaagattccgttgcgcatttacaccgctgatgagatccag
atcggtgagttcggcgaggagcgccgaaatctcgtgcgctttgccgacattcccgacgtc
atgaagaaagccgtgcttgccatcgaggacgaccgtttctatcagcacggcggcgtggat
ttcatcggcatcttccgtgcaggcgtggcgaacttcacgcgtggcggttcctcacagggc
gccagcacgatcacgatgcaggtcgcgcgcaacttcttcctgtctagcgagaagacgtac
acgcgcaagatctatgaagctctgcttgcctacaagatcgaatcgcgcctgtcgaaagat
cagattcttgagctctacatgaatcagatctacctcggcgagcgggcatatggcttcgcc
agtgcggcacgcgtgtatttcggcaaggacctgaaggacatcacgctcgcggaagccgcc
atgctcgccggactgccgaaggcgccttcggcgtacaacccgatcgtcaattacaagcgc
gcgcgtgtgcgccaggaatacatcctgaagcgcatgtacgaccttgggtacgtgtcgaaa
gccgagtacgaccaggcgattgcgcaagagatggtcgtgcgggggctgggcagcgagttc
agcgtgcatgccggatacgttgcggaaatggtgcgccaactgctctacgcacagttcaag
gacgagatttacacgcgtggcttcaacgtctacacgaccattaattcggcggatcaggaa
gcggcgtacgaagcgctacgcgccggcgtcatggcgtacgaattgcgccatggctatcgc
ggccccgaagccaatatcgatctgccggacggcaaggacgaacgcgagcaactgatcgac
gacaccctggtggagcaccccgacagcggcgacatggtcgcggccgtggtcctgtcggca
acgccgcagcaagtgaaagcggtactgctcaacggcgacgatgtcaccgttaccggggac
ggactgcgctttgccgccgctggcctgagtgccaaggcgcagcccaagcagaagattcgc
gcaggctcggtgattcgcgtgacgaaggacgccaaggagaactggcgcatcgtgcagatg
cccgacatcgaagcggcgttcgtctcgctcgatccgcagaatggcgcgatccgttcgctc
gtcggcggcttcgacttcaaccggaacaagttcaatcacgtcacgcaggcatggcggcag
ccggggtcgagcttcaagccgttcatctactcggctgcgcttgaaaagggattcgcaccg
gcaaccatcatcaatgacgcaccgctgtatttcacggcggcgcaaaccggtggacagcca
tgggagccgaagaattacggcggcggcttcgatggacctgaaccgatgcgcgtcgcgttg
atgcgctcgcgcaacctcgtctcgattcgtattcttcagagcattacgcccgggtacgcg
cagaagttcatcggccgattcgggttcgaagcggacaagcatcccgcctacctgccgatg
gcgctgggtgccggcatggtcacaccattgcagatggctagcggctatgcggtgttcgcg
aacggcggcttccgggtaaatccgtttatcgtagcccgcatcacggactcgaagggcagc
gtcatcatggaagaaaagccgaccacggccggggacgagtcgatccgcgccattccggcg
cgcaatgcgttcctcatgaattcgatgctgcacgacgtagcaacgcgcggtacggcggcc
aaaaccaatgcgctcaagcgcagcgatctcgcgggcaagactggcacgacgaacgactcg
cacgacgcgtggttcgcgggctatcagtctcagttggtgggtgtggcctggattggcttc
gatcagccgcgaaacctgggggatcgggaaaccggtggcggcttggcgctgccgatctgg
atcgactacatgtcgaaggcgctgcgtggcgtaccggaggcaacgcgcccgatgccgccg
ggcatcattcaggcgaacggcgactacttctatgacgactatccgccgggacgtgccgtc
agcacggtgggactgagcgcagaaccggcgccggacggctcggcgtcgccagggccatcg
ggtgcactgcccggtcagatgccggcgcagtcgggaccggcgccagcacctgccccggtc
gaccgacaggaacgtcagcgtatcctggatatgtttaacagcaagccttga

DBGET integrated database retrieval system