KEGG   Proteus vulgaris: CRN77_02375Help
Entry
CRN77_02375       CDS       T05486                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
pvg  Proteus vulgaris
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvg01002]
    CRN77_02375
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pvg01011]
    CRN77_02375
Enzymes [BR:pvg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CRN77_02375
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CRN77_02375
Peptidases [BR:pvg01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   CRN77_02375
Peptidoglycan biosynthesis and degradation proteins [BR:pvg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CRN77_02375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ATM98641
UniProt: A0A292C5I0
LinkDB All DBs
Position
555273..556502
Genome map
AA seq 409 aa AA seqDB search
MKKHFLKYLMIPVALLTLNACSQRSSLPPATQPSMLNQQNNVPELTQWPTALSPNVSNAS
ALFDKYASQIYQKSNPQGMVIVMINNSQTLNRSFGTTTPESRNAPSMNSLIRIASITKLM
TSEVMLKLQDDGKLLVTDPLQKYSYYGVNIPLVSAQSPIRLYHLASHTSGFPREQPGGKW
GRPVFIWPTHGDRWNWLKKATLTSTAGDQAAYSNLAYDLLADALVKASGKSYPQLLQQYV
TRPAGMTSTTLTPTPEQCQRLLVGYKPSPCSDTIAAAGSGGVYSTPADMQRWMQGFLTSH
NTMRKATASKEQSVYFPRNRLSSIEGMDVAGRADGVGLGWVYMAPSNGVPAIYQKTGGGG
GFNTYMATIPELNIGVFVVITRKPNGTKFSEVTQGTNALVRALAKDFYQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacattttctaaagtatcttatgatccctgtcgctttactgacattgaatgcg
tgtagccaacgttcgtcattaccaccagcgacacaaccgtctatgttaaatcaacagaac
aatgtgcctgaactgacgcaatggcctacagcattaagccctaatgtaagtaatgcaagt
gcgttgtttgataaatacgcttcacagatttatcaaaaaagtaatcctcaaggcatggtt
attgtcatgatcaataactctcaaaccttgaaccgttcttttgggacgacaacacctgaa
agtcgcaatgcaccatcaatgaactcactgatccgtatcgcttctatcacaaagctgatg
accagtgaagtgatgttaaagttacaagatgatggaaaattattagtcaccgatccacta
caaaaatacagctactacggcgtaaatatcccattagttagcgctcaatcccctatccgt
ctttatcatttagcaagccatactagtggctttccacgagaacaacccggcgggaaatgg
ggaagacctgtttttatatggccaacacatggcgaccgctggaactggttgaaaaaagca
acgctgacatcaactgctggggatcaagccgcttattcaaacctagcttacgatctatta
gcggatgccttagtgaaagcatctggtaaaagttatcctcaacttttacaacaatatgtc
actcgacctgcgggtatgactagcaccacgttgacgccgactccagaacaatgccaacga
ttattagtaggatataaaccaagcccatgctctgacaccattgcagcagccggaagtggc
ggtgtgtactcaacaccagccgatatgcaacgttggatgcaaggctttttgacttctcat
aataccatgcgaaaagcaacggcaagtaaagagcaatctgtctactttcctcgtaatcga
ctctcttcaatagaaggtatggacgttgcaggtcgtgctgatggtgtaggtttaggctgg
gtttatatggctccatccaatggtgttccagcgatttaccaaaaaactggcggtggtggc
ggctttaatacttatatggcaaccattcctgaattaaatatcggtgtatttgtggtgatc
acccgtaaacctaacggcactaaatttagtgaagtcactcaggggactaatgcccttgtt
cgtgctctagcaaaagatttttatcagtga

DBGET integrated database retrieval system