KEGG   Proteus vulgaris: CRN77_02630Help
Entry
CRN77_02630       CDS       T05486                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
pvg  Proteus vulgaris
Pathway
pvg00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CRN77_02630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvg01002]
    CRN77_02630
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pvg01011]
    CRN77_02630
Enzymes [BR:pvg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CRN77_02630
   3.4.21  Serine endopeptidases
    3.4.21.-  
     CRN77_02630
Peptidases and inhibitors [BR:pvg01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   CRN77_02630
Peptidoglycan biosynthesis and degradation proteins [BR:pvg01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CRN77_02630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ATM98686
UniProt: A0A292C4E8
LinkDB All DBs
Position
607065..608507
Genome map
AA seq 480 aa AA seqDB search
MRLLSTFRRILYTLSIISFSTQAIPVENYTSLLPEGTQVGLITQPVGAASPNLNYHADQL
ALPASTQKVVTALAALLQLGGNYQFTTTMETEGKIKDNQLIGDLIFRFTGDPTLTRQQLR
AMVAVLKQSGVTKVHGDLLIDTSAFSSHDKAPGWVWNDLTQCFSAPPSAAIVDKNCFSVL
LQSGNKEGDIATIRKASFYPVTVLSEVETYEKGSTRTRFCELDVTVRDLNTYVITGCIPK
RDDAVPLMFSIQDGAHWAGTILKEELQRANIELDGYVKRRSQLKVPVTVLAQTQSKPLHN
LLTTMLKESDNMIADTVFRTIGREYYGVAGTWRSGAEATRAILKQKAGIDLGNTVMVDGS
GLSRHNLISPATMMQILQYIGQHESELNFIAMLPLAGHDGTLQYRGGFHEAGVDGKVSAK
TGSLKGVYNLAGFMTTANGQKVAFVQYVSAYSPPTQNRNAGRAYLVRFETNLYKDMYNNR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttactatcaacatttcgacggatactctacacattaagtatcatcagtttttca
acccaagcgatacctgttgaaaactacacatcccttcttcccgaaggaactcaagtaggt
ttaattactcaacccgttggcgctgcttctcctaatcttaattatcatgccgatcaatta
gcacttccagcaagtactcaaaaagtggtgactgcacttgcggcattacttcaattaggt
ggaaactatcaattcacaacaacaatggaaacagaaggtaagataaaagacaatcaactt
attggtgatttgatctttcgttttacaggcgaccctacattaactcgccaacaattaaga
gcaatggttgccgtattaaaacaatcaggtgttacaaaagtgcatggcgatttgcttatt
gatacttctgctttttcaagccatgacaaagcacccggttgggtttggaatgatctaact
caatgctttagtgcccctcctagtgctgctattgttgataagaactgcttttctgtctta
ctgcaaagtggcaacaaagaaggtgatattgccacaatacgtaaagcctctttctatcct
gtaaccgttttaagtgaagttgaaacttatgagaaaggatcaactcgtactcgtttttgt
gaattagatgtcactgttcgtgatttaaatacctatgtaatcacaggttgtattcctaaa
cgtgatgatgcagtccctttaatgttctctattcaagatggtgctcattgggctggtaca
attttaaaagaagagttacagcgcgccaatattgaacttgatggatatgtcaaacgtcga
tctcaactaaaagtaccggttactgtattggcacagacacaatcaaaaccgttacataac
ttactgactaccatgctaaaagagtctgacaatatgattgcagacaccgtatttagaact
attggtcgtgagtattatggtgttgccggcacttggcgctctggcgcagaagcaacccgt
gctattttaaaacaaaaagccggcattgatttaggaaataccgttatggttgatggctct
ggcctttctcgtcataacctcatttcacctgcaaccatgatgcaaatccttcaatacatt
ggacaacatgaaagtgaattaaattttattgccatgcttccccttgcaggacatgacggt
acattacagtatcgaggcggttttcatgaagcgggtgttgatggcaaagtttctgccaaa
acgggttcattaaaaggggtttacaatcttgcgggctttatgaccacggcaaacggacaa
aaagtggcgtttgtacaatacgtttcggcgtattcaccccctacacagaatcgtaatgct
ggacgcgcttatttagtgcgttttgaaacaaatctgtataaagatatgtataacaaccgc
tag

DBGET integrated database retrieval system