KEGG   Proteus vulgaris: CRN77_06670
Entry
CRN77_06670       CDS       T05486                                 

Definition
(GenBank) glycosyltransferase
  KO
K19354  heptose III glucuronosyltransferase [EC:2.4.1.-]
Organism
pvg  Proteus vulgaris
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pvg01003]
    CRN77_06670
   01005 Lipopolysaccharide biosynthesis proteins [BR:pvg01005]
    CRN77_06670
Enzymes [BR:pvg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     CRN77_06670
Glycosyltransferases [BR:pvg01003]
 Polysaccharide
  Bacterial polysaccharide
   CRN77_06670
Lipopolysaccharide biosynthesis proteins [BR:pvg01005]
 Core region
  CRN77_06670
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 ATP-synt_E_2
Other DBs
NCBI-ProteinID: ATM99429
UniProt: A0A292C7X6
LinkDB
Position
1492038..1493027
AA seq 329 aa
MSSFVPQLSIVVAVYNGEKFLSKFFNYLQAQKLPSWELILVDDGSNDNSLKLLYEWKGKF
PDVTILTQENQGVSVARNSGFNVARGKYVAFPDIDDVIDARMYPRLLEIALADDLDIATC
NGNYVYADGRPSRPIFPSNRLHSTDVLTGPQWLEMALNSKKFLHVTWLNIYRREFLLAHG
YYFEPGLHHQDIPWTTEALLTAKRVKYIDERYYDYFIHSESVSHKTPNDTIHVRTIHNYM
KILEMLDAINQKHKEVSQNINACYWQIAKEGLGIIHSIGSIQSIKVKKQIVKELFDRGIW
TLIWQNAKDFRLRWRLGRRYFKLKRILNT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtcttcttttgtacctcaattaagtattgtcgttgccgtttataatggtgagaaattt
ttatcaaaatttttcaactatttacaagcgcagaaactaccgagttgggagcttattctt
gttgatgatggttctaacgataattcattaaaattgctttatgaatggaaggggaaattt
cctgatgtcactattttgacacaagaaaaccaaggtgtttccgttgcgcgtaattctgga
tttaacgtcgcacgtggaaaatacgtggctttccctgatattgacgatgttattgatgcc
agaatgtatcctcggctacttgaaatcgctctggcggatgatttagatatcgcgacttgc
aatggtaattacgtctatgcggatgggcgtccttcgcgtcctatctttccatctaatcga
ttacattcaacggatgttttaactgggccacaatggctagaaatggcattaaattctaag
aaatttttgcatgtgacttggttaaatatctatcgacgtgaatttctacttgctcatggt
tattattttgagccaggtttacatcatcaagatattccgtggacaacagaagcattatta
accgctaaacgtgttaaatatattgatgagcgttactacgactactttattcattctgaa
tctgtttctcataaaacacctaatgatactattcatgttagaacaattcataattacatg
aaaatattagaaatgcttgatgctattaatcaaaagcataaggaagtgtctcaaaatatc
aatgcatgttattggcaaatcgcaaaagaaggtttaggaattattcactcaatcggttct
attcaatctattaaagttaaaaaacaaatagttaaagagctttttgataggggaatttgg
acacttatctggcagaatgcgaaagattttagattgcgttggcgtttaggacgacgctat
ttcaaattaaaaagaatattaaatacataa

DBGET integrated database retrieval system