KEGG   Proteus vulgaris: CRN77_07215Help
Entry
CRN77_07215       CDS       T05486                                 

Definition
(GenBank) bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
pvg  Proteus vulgaris
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CRN77_07215
Enzymes [BR:pvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     CRN77_07215
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     CRN77_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase
Motif
Other DBs
NCBI-ProteinID: ATM99529
UniProt: A0A292C867
LinkDB All DBs
Position
1613055..1615895
Genome map
AA seq 946 aa AA seqDB search
MSVISVFQQLWNKAQCGFSSQLNALAPFSELEQQFFAFSPFATEHLRVNPQWLTDIRQNP
PTSVEWQSYEFQLTEKLANVDNEDDVMRILRQFRHQQLVRIAWLQFFQLGDIPCALKHLS
VLAETLICIARDTLYQQCCQQWGTPCDHEGKPQPLLILGMGKLGGFELNFSSDIDLIFAY
PENGFTQGGRRELDNAQFFTRLGQKLIKALDQHTIDGFVYRVDMRLRPFGESGPLVMSFA
ALEDYYQEQGRDWERYAMIKARVLGAEKKEYCQILRQMLRPFVYRRYIDFSVIQSLRNMK
SMISREVRRRGMIDNIKLGSGGIREIEFITQVFQLIRGGREPELQSNSLLTVLNVITKLE
LLTSQETARLTESYLFLRRLENLLQSIGDQQTQTLPESEEDKVRLTFAMGFDDWETLYQE
ISHKMQAVSVIFTQLIGEEDENDDEDDISEFKRLWLLGRLPETSSLFHETLTIEALEAIN
QTLQNFRQDIGKRTIGPRGRDVLDALMPKLLAKICQQPQTLVTLQRVTPLLLSIVSRTTY
LELMQESDEVLTHVIRLCAASPMIAEQLALHPLLLDELLDPNSLYQPLPLDAYRDELRQY
LLRVPEEDEEQRLEALRQFKQAQLLRIAAEDITGVLPVMKVSDHLTYLAEAIIHAVVHQA
WSYMVKRYGEPEHLAHRDGLGFAVIGYGKLGGWELGYSSDLDLVFLLDCPINTVTTGAKQ
IDARQFYLRLAQRIIHLFSTRTSSGVLYEVDARLRPSGESGMLVSTIQAFDEYQKNEAWT
WEHQALIRARMIYGDDELQQMFSRIRHETLCLSRDADVLQNEVRDMRRKMVQHLAPTQAD
KFDLKTSSGGITDIEFIAQYLVLRFSHQYPALTRWSDNVRIFELMAKHQVMDKDEALALT
HAYVTLRNELHHLALQALPAIVDNHCFIAERECVLKSKLKWLGEQE
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttatcagtgtatttcaacaattgtggaataaagcacagtgtgggttctcttct
caattaaacgcgttagcaccttttagtgagctcgaacaacagttttttgcttttagccct
tttgcaacagagcatttacgcgttaatcctcaatggttgactgatatcaggcaaaatcca
ccaaccagtgtggagtggcagagttatgagtttcaattaacagaaaaattagccaatgtt
gataatgaagatgatgtgatgcggatcttacgccaatttcgtcatcaacaattagtgcgc
attgcatggctacaattttttcaattaggcgatattccttgtgcgctaaaacatttgagc
gtattggctgaaacattaatttgtattgcgagagatacgctttatcagcaatgttgccaa
caatggggaacaccttgtgatcatgagggaaaacctcagccattactgattttaggaatg
ggaaaactaggtgggtttgaacttaacttttcttctgatatcgacttaatttttgcctac
cctgaaaatggatttacacaaggtggacgcagagaattagataatgcacagttttttact
cgcttaggtcaaaagcttattaaggctttggatcaacatactattgatggctttgtctat
cgtgttgatatgcgattacgtccttttggtgaaagtggtcctttggtaatgagttttgca
gcactggaagattattatcaagagcaagggcgcgattgggaacgctatgcgatgatcaaa
gcgcgtgttctaggtgctgaaaagaaagaatattgccaaattttacggcaaatgttgcgt
ccttttgtttatcgtcgttatattgattttagtgtgattcaatcacttagaaatatgaaa
tccatgattagtcgagaagtccgtcgtcgtggcatgattgataacataaaattgggctct
ggagggatacgtgaaattgaatttattactcaggttttccagctaattcgtggaggaaga
gagcccgagttacaaagtaattcattattaacagtgcttaatgtcatcactaaacttgag
ctgttaacatcacaagaaaccgcgcgactaactgaaagttatcttttccttcgtcgatta
gaaaatttactgcaatctattggtgatcaacaaactcaaaccttacctgaaagtgaagaa
gataaagtacggttaacttttgcaatgggatttgatgattgggaaacgctttatcaagaa
attagccacaagatgcaggctgtttccgtgattttcacgcaattaattggtgaagaagac
gagaacgatgatgaagacgatatctctgaatttaagcgtctttggttattagggcgtttg
cctgaaacgtcgtcattatttcatgaaacattaaccatcgaagctcttgaagcgataaat
cagacgttgcagaattttcggcaagatattggcaagcgaacgatcgggccgagagggcgt
gatgttcttgatgccttaatgccaaaactattagctaaaatttgccaacaacctcaaact
ctagtgacactacaacgcgtgacgcctctgttattaagcattgtgagtcgcacaacgtat
ttagagttgatgcaagagtcggatgaagttttaacgcatgttatacgactctgtgcggca
tctccgatgatcgctgaacagttagcgcttcaccctttattgctagatgaattacttgat
cccaattctctttatcaacccctacctttagatgcgtatcgtgatgaattacgacaatat
ttattacgtgtgccggaagaagacgaagagcaacgattagaagcattacgtcagtttaag
caagctcaattactacgtatcgccgctgaagatattacaggtgtattaccagtcatgaag
gttagcgaccacctaacttatttggctgaagctattattcatgctgttgttcatcaagct
tggtcatatatggtgaaacgttatggtgagcctgaacatttagctcatcgtgatggactg
ggttttgcagtgattgggtacggtaaattggggggatgggagctaggatatagctctgat
ttggatttggtctttttattagattgtccaataaatacggtgacaacgggagcaaaacag
attgatgctcgccaattttatctgcgtttagcacagcgcattatccatttatttagtacc
agaacatcttctggtgtgttgtatgaagtcgatgcgcgcttacgcccttcaggtgaatct
ggtatgttggttagtactattcaagcttttgatgaatatcagaaaaatgaggcttggact
tgggaacatcaagcgctaattcgtgccagaatgatttatggtgatgatgaattacaacag
atgttttcacgtattcgtcatgaaacactatgtctttctcgtgatgctgatgtgttacaa
aatgaagtgcgcgatatgcgtagaaaaatggtgcaacatcttgcaccaacacaagcagac
aaatttgatttaaaaacttcatctggcggtattaccgatattgaatttatcgcgcaatat
ttagtattgcgtttttctcaccaatacccggctttaactcgttggtcggataatgtgcgt
atttttgagttaatggcaaaacatcaagtgatggataaagatgaagctctcgctttaaca
catgcttatgtcacattgcgcaatgaattacatcatctggcgctacaagcattacctgct
attgtggataatcattgttttatcgcagagcgcgagtgcgtattaaaaagcaaactgaag
tggctcggtgaacaagagtaa

DBGET integrated database retrieval system