KEGG   Proteus vulgaris: CRN77_09930Help
Entry
CRN77_09930       CDS       T05486                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
pvg  Proteus vulgaris
Pathway
pvg00061  Fatty acid biosynthesis
pvg00780  Biotin metabolism
pvg01100  Metabolic pathways
pvg01212  Fatty acid metabolism
Module
pvg_M00083  Fatty acid biosynthesis, elongation
pvg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CRN77_09930
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CRN77_09930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pvg01004]
    CRN77_09930
Enzymes [BR:pvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     CRN77_09930
Lipid biosynthesis proteins [BR:pvg01004]
 Fatty acid synthase
  Component type
   CRN77_09930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ATN00021
UniProt: A0A292C8S6
LinkDB All DBs
Position
2235423..2236634
Genome map
AA seq 403 aa AA seqDB search
MKRAVITGLGIVSSIGNNQKEVLDSLKEGRSGITFSEEFKEMGLRSHIWGNVKLDTEGLI
DRKIRRFMSDASVYAYLSMQEAIADSGLTEDQVSNIRSGLVVGSGGGSPRNQVQGSDGMR
AKGLRGVGPYMVTRAMASGVSACLATPFKIKGVNYSISSACSTSAHCIGHAVELIQLGKQ
DVVFAGGGEELSWEMTCEFDAMGALSTKYNETPTKASRTYDKNRDGFVIAGGGGIVVVEE
LEHALARGAHIYGEVVGYGATSDGADMVAPSGEGAVRCMQMAMQGVDKVDYINTHGTSTP
VGDLKELEAIAEVFGSHTPAISATKAMTGHSLGAAGVHEAIYSLLMLEHGFIAPSINIEE
LDDKAMGMNIITQPTEQKLETVMSNSFGFGGTNASLVMSKYKK
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgcagtgatcacgggtctgggtattgtttcgagcattggtaataaccagaaa
gaagtgctggattctttaaaagaaggtcgttccgggataactttctcagaagaatttaaa
gagatggggcttcgtagccacatttggggcaacgttaagcttgatactgaaggtcttatt
gaccgtaaaatccgccgttttatgagcgacgcatcggtttatgcctatttatctatgcaa
gaggcgatagctgattcaggtctgactgaagaccaagtttctaatattcgttctggctta
gtcgttggttctggtggtggctctccacgtaaccaagtccaaggttctgatggcatgaga
gcaaaaggcctacgtggcgtaggtccttatatggtaactcgtgcaatggcatcaggtgtt
tcagcttgtttagcaacacctttcaaaattaaaggcgttaactattcaatcagttctgct
tgttcaacatcggcacactgtattggtcacgccgttgagcttatccagttaggcaaacaa
gatgttgtatttgctggtggtggtgaagagttaagttgggaaatgacctgcgaatttgac
gcaatgggcgcactctcaactaaatataacgaaactccaaccaaagcttctcgtacttac
gataaaaaccgtgatggttttgttatcgctggcggtggcggtattgtggttgttgaagag
ttagagcacgcattagcgcgtggtgcacatatctatggtgaagtcgtaggttatggcgca
acgtctgatggtgcagacatggtggctccttcaggtgaaggtgcagtgcgttgtatgcaa
atggcgatgcaaggtgttgataaagttgattatatcaatacacacggtacttcaacgcca
gttggcgatctaaaagagcttgaagctatcgcagaagtgtttggctcgcatacaccagct
atctcagcaacaaaagcaatgactggtcactcattaggtgcggctggtgtgcatgaagca
atttatagcttactgatgttagagcatggatttattgcaccaagcatcaatattgaagaa
ttagacgataaagcaatgggtatgaacatcattactcaaccaacagaacagaagctggag
actgtaatgtcaaatagctttggttttggtggtacaaatgcttcactagtcatgagtaaa
tataaaaaatag

DBGET integrated database retrieval system