KEGG   Proteus vulgaris: CRN77_12850Help
Entry
CRN77_12850       CDS       T05486                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pvg  Proteus vulgaris
Pathway
pvg00473  D-Alanine metabolism
pvg00550  Peptidoglycan biosynthesis
pvg01100  Metabolic pathways
pvg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CRN77_12850
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CRN77_12850
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CRN77_12850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pvg01011]
    CRN77_12850
Enzymes [BR:pvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CRN77_12850
Peptidoglycan biosynthesis and degradation proteins [BR:pvg01011]
 Precursor biosynthesis
  Amino acid ligase
   CRN77_12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: ATN00562
UniProt: A0A292CB39
LinkDB All DBs
Position
2874065..2875165
Genome map
AA seq 366 aa AA seqDB search
MSKLRVAIIFGGKSTEHQVSLQSAKNIINELDRTKFDLCLIGINEQGQWHEYSETDYLLN
SDNPKTISLSNPLRAVAIIPGSVKGQFISLEDGQALPQIDVVFPIVHGAYGEDGTLQGLL
HMIDMPYVGPNIMSSAACMDKDITKRLLDGAGLAIAPFITIMAHQVNDIPYNEMVRQLGL
PLFIKPANLGSSVGISKVNNEEEFNAALEMAFEYDLKVIVESAIVGREIECAVLGNEAPE
VSPCGEIVLNDSFYAYNTKYIDEDGAKVVVPAVMDENTSLHIRQVALKAYRVLNCLGMAR
VDVFLTQDNRVVINEINTLPGFTNISMYPKLWQSAGLGYQSLITKLIELALDHHRKTAVL
KTKCEL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaagagtcgctattatttttggtggtaaatccacagaacatcaagtttca
ttacagtcagcaaaaaacattattaatgaattagatcgaacgaaattcgacctttgctta
atcggtattaatgaacaaggtcagtggcatgaatattcagaaactgactatttactaaat
agcgataatcctaaaaccatttcattaagcaatcctttaagagcagttgctattattcct
ggtagtgtaaaaggccaatttatttcacttgaagatggtcaagcgttacctcaaatcgat
gttgtattcccaattgttcatggtgcgtacggtgaagatggtacacttcaaggcttgtta
catatgattgatatgccttatgtaggaccaaatatcatgagttcagcagcttgtatggat
aaagatattactaaacgtctgcttgatggtgcaggattagctattgctccatttattacc
attatggcgcatcaagttaatgacattccttacaacgaaatggttcgtcaattaggactt
cctttatttattaaaccagcgaacttaggttcttctgtaggaattagcaaagttaataat
gaagaagagtttaacgcggcattagaaatggcctttgagtacgatcttaaagtgattgtt
gaaagtgcgattgtgggccgtgaaatagagtgtgctgttttaggtaatgaagctccagaa
gttagcccttgtggtgaaatcgtgttaaacgattctttctatgcttataacacaaaatat
attgatgaagatggtgctaaagtcgttgttccagcagtaatggatgaaaatacgagtttg
catattcgccaagttgctttaaaagcataccgtgttcttaattgcttaggtatggctcgt
gttgatgtgttcttaacacaagataatcgtgttgtgattaatgaaataaacacactacct
ggttttaccaatatcagtatgtatccaaaattatggcaaagtgcaggtttaggttatcaa
tcattaattactaaattaattgagttagcactagatcaccatagaaagacggcagtttta
aaaacaaagtgtgagctttaa

DBGET integrated database retrieval system