KEGG   Proteus vulgaris: CRN77_13350Help
Entry
CRN77_13350       CDS       T05486                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pvg  Proteus vulgaris
Brite
Enzymes [BR:pvg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CRN77_13350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ATN00657
UniProt: A0A292C9Y5
LinkDB All DBs
Position
complement(2979306..2979830)
Genome map
AA seq 174 aa AA seqDB search
MKLMPLLLSGLLFTSVASATTLDVTLKEALPTGAGNDIGVVTITETDYGLLFTPKLAGLT
PGIHGFHIHANGSCEPDMKDGKPVPALKAGGHLDPEKVGIHLGPYNKNGHLGDLPGLVVN
DKGVANYAVLAPKLTKLEQVKDKAIMVHVGGDNYSDDPEALGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatgcctttgttactatctggcttactcttcacttctgtggcaagcgctaca
acgttagatgtcacgttaaaagaagccttaccaacgggtgctggcaacgatattggtgtt
gtcactatcactgaaactgattatgggctgttatttacaccaaaactcgctggattaaca
ccgggtattcatggttttcatattcatgctaatggttcttgtgaaccagatatgaaagat
ggcaaacctgtgcctgctttaaaagctggcggccatttagatcctgaaaaagttggtatt
cacttggggccttataataaaaatgggcatctaggtgatttaccgggattagtcgtgaat
gacaaaggtgttgctaattacgcagtattagcgccaaaactcactaagcttgaacaagtg
aaagacaaagcaatcatggtgcatgttgggggagacaactattctgatgatcccgaggct
cttggcggtggtggtgcaagaatggcatgtggtgtgattaaataa

DBGET integrated database retrieval system