KEGG   Chlorobium phaeovibrioides: Cvib_0402Help
Entry
Cvib_0402         CDS       T00499                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00970  Aminoacyl-tRNA biosynthesis
pvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cvib_0402
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pvi03029]
    Cvib_0402
Enzymes [BR:pvi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cvib_0402
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cvib_0402
Mitochondrial biogenesis [BR:pvi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cvib_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ABP36424
UniProt: A4SD65
LinkDB All DBs
Position
413050..413337
Genome map
AA seq 95 aa AA seqDB search
MSVTIDDVTYIAELARLRFSDDEALKMTDELNTILHYVDTLNEVDTEGVLPLSNIHDQKN
VLRADEEHEPIANAAALSNAPDSQDRFFRVPKVLG
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaccatagatgatgtaacctatatagccgaactggcccggcttcgtttcagt
gatgatgaggcgctcaagatgactgacgaactcaacaccattctgcactatgtcgatacc
ctcaacgaggttgataccgaaggggttcttccgttgagcaatatccatgaccagaaaaat
gtgcttcgtgcggacgaggagcatgagccgattgccaatgcagctgcgctcagtaacgct
cccgacagtcaggatcgttttttccgggttccgaaggttcttggctga

DBGET integrated database retrieval system