KEGG   Chlorobium phaeovibrioides: Cvib_0784Help
Entry
Cvib_0784         CDS       T00499                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01130  Biosynthesis of antibiotics
pvi01230  Biosynthesis of amino acids
pvi02024  Quorum sensing
Module
pvi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cvib_0784
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cvib_0784
Enzymes [BR:pvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Cvib_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABP36799
UniProt: A4SE90
LinkDB All DBs
Position
883973..885022
Genome map
AA seq 349 aa AA seqDB search
MEQLQDLRVSGITRLSAPRVLKEKLPVDENAASVILSGRREIEDILTCRDQRMLVIVGPC
SIHDIGAAEEYARHLTELREELKNELCIVMRVYFEKPRTTVGWKGFINDPHLNDTYDIEH
GLYYARKLLLDINAMGLPAATEFLDPISPQYVADVVSWAAIGARTIESQTHRQMASGLSM
PVGFKNSTDGRISVAVDAIRSAMHPHSFLGIDQDGHSSVITTKGNPFGHLVLRGGPHPNY
DPASITAAEALLSKGGLRQALLVDCSHANSGKKHAEQLNVWENVLGQKVDGNKSIAGVMI
ESNICSGNQPFPEDPAKLRYGVSITDECVSWKETERMLREGAEVMRTIL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaacagttacaggatttaagagtttcgggtattacccgtctttcagccccccgtgtg
ctgaaagagaaattgccggtcgatgagaatgccgcctccgtcattctttcaggccgtcgc
gagattgaagatattttgacctgcagggaccaaaggatgctggtgatagtagggccatgc
tccatccatgatattggagcagcagaggaatacgcccggcatctcacggaactgcgtgaa
gagctgaagaatgagctctgtattgtcatgcgtgtctattttgagaagccgaggacaacc
gtcgggtggaaaggattcatcaacgatccccacctgaatgatacttatgatattgagcac
ggactctattacgcgcggaaactcctgcttgacatcaatgccatggggctgccggcagca
accgaatttcttgatcccatttcaccccagtatgtggcggatgtagtcagctgggcggcc
ataggtgcgcgtaccattgagtcgcagacgcacaggcagatggcaagtggcctctccatg
ccggtaggattcaagaactccaccgatgggcgcataagcgttgctgtagatgccatccgc
tcggccatgcatccgcatagttttcttggtattgatcaggacggtcacagcagtgtgatt
acaaccaaaggaaacccgttcggtcatctggtccttcgtggaggaccgcaccccaattat
gatccggccagcatcactgccgcagaggctcttctttcaaaaggaggcctccgccaggct
cttcttgttgactgcagccacgcaaactcagggaaaaaacatgccgaacagctcaatgtg
tgggagaatgttctcgggcagaaggttgatggcaataaaagcattgcaggtgtcatgatt
gaaagcaacatatgctcgggtaatcagccgttcccggaagatcccgccaagcttcgttac
ggagtttccattactgatgaatgtgtttcctggaaagagactgaacggatgctccgcgaa
ggggcagaagtaatgcgcactattttatag

DBGET integrated database retrieval system