KEGG   Chlorobium phaeovibrioides: Cvib_0978Help
Entry
Cvib_0978         CDS       T00499                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Brite
Enzymes [BR:pvi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cvib_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABP36992
UniProt: A4SET3
LinkDB All DBs
Position
1098690..1099295
Genome map
AA seq 201 aa AA seqDB search
MAYQQPALPWAENALEPHISAKTLGFHYGKHHAAYVTNFNNLVGGTPMDLMSLEEVIAQT
AGDSSKAGIFNNGAQAWNHSFYWNSLAPAGGGVPTGELGEAITRDFGSFDKFRDELKNAA
ATQFGSGWAWLVLDGETLKVVKTGNAETPMTNGLKPILTIDVWEHAYYLDYQNRRPDYTA
AVIENLLNWEFAAANYASARS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagcaacccgcacttccctgggccgaaaatgcgcttgaaccgcacatctcc
gcaaaaactcttggattccattacggaaagcaccatgcggcatatgtcaccaacttcaac
aaccttgtaggtggcacaccaatggacctcatgagccttgaagaggtcatagcccaaaca
gcaggcgacagctcgaaagccggtattttcaacaacggagcgcaggcctggaaccacagt
ttttactggaactccctcgcacccgcaggcggcggtgttcccacaggagaacttggtgaa
gccattaccagagactttggcagttttgacaagttccgtgacgaactgaaaaatgcggcc
gcaacacagttcggcagcggctgggcatggcttgtccttgatggagaaacactgaaggtc
gtcaaaacaggcaatgcagagaccccaatgaccaacggtctgaaaccgattctgaccatt
gatgtatgggagcatgcctactatcttgactaccagaaccgcaggcccgactacaccgca
gcagtcattgaaaatctgctcaattgggaatttgcagcagccaattacgcaagcgccagg
agttga

DBGET integrated database retrieval system